BDGP Sequence Production Resources |
Search the DGRC for RE73208
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 732 |
Well: | 8 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG14275-RA |
Protein status: | RE73208.pep: gold |
Preliminary Size: | 447 |
Sequenced Size: | 861 |
Gene | Date | Evidence |
---|---|---|
CG14275 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14275 | 2002-03-28 | Blastp of sequenced clone |
CG14275 | 2003-01-01 | Sim4 clustering to Release 3 |
CG14275 | 2008-04-29 | Release 5.5 accounting |
CG14275 | 2008-08-15 | Release 5.9 accounting |
CG14275 | 2008-12-18 | 5.12 accounting |
861 bp (861 high quality bases) assembled on 2002-03-28
GenBank Submission: AY071652
> RE73208.complete AGTTACACGTTGAATTTGCAGTAGATTGGTTCTACTGTCGGTGGGAATTT AAACACTTAAAGTCAAACAAACAAAAACTAACAATAGAAGTGCAACAAAA CAGTAAAAAATTTCAAAAGAAAAAAGCATCAGCGTTGGAGAAGTCTACTG GAAATCTAGTAACTGCAATCAAAAACCACAAAATGGCAATCACAACCTAC GTCTATGCCATGTGCCTTGTTTTGGCCGCCAATTTGTTAACAGTGAATGC CATTCGGTGCCATCAGTGTAATTCGCATGACAACGAGGATTGCGGTGGCC TGGTGGTGAACACTCCTCGTGCCCAGAGGGACAACCAGTACCTGACGGAC TGCGTCCCGCCCAGCGGTGAGGTGGCCTTCTGCCGCAAGACGGTGATCAA TTTCGAGCAGAACGACGAGCGCAGAATCGAGAGAAGCTGTGGTTTCATTC CGGAGAAGATCCAAAACGCTTGCTTCACCGCCGACAACGAGGGCTACAAG CAGATCATTTGCACCTGTCCCGACGAGGGATGCAATGGAGCCAGCTCCCT GCTGGGTGTCCGCCAGTTGGGCTACAGTCTGGTTGGATCTGTCGTCAGTC TGGCACTGGCCAGCATGCTCAGGCATTAGGTCATCGATCAGCTCACCTTC AGCTCCTGCATCCTGTTTTCTCCATTCAAAACGTACCTAATCCTAACTGG TTAAGCTAAGTCTTAAATATTTTGCACTAAGTTCTTTGCTGTTTGCCATA TTTAGTTATGTATACGTGGCAGCTATTTCGCGTTTAGTCTTGTATTCTGT ATTTTTATATTTAATTACTATAAAAATATAAGCATCGTATTTAAAAGAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 8331220..8331826 | 241..847 | 3005 | 99.7 | Plus |
chr2L | 23010047 | chr2L | 8326362..8326487 | 1..126 | 630 | 100 | Plus |
chr2L | 23010047 | chr2L | 8328551..8328669 | 125..243 | 580 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 6585..6743 | 38..195 | 179 | 59.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8326362..8326487 | 1..126 | 100 | -> | Plus |
chr2L | 8328553..8328669 | 127..243 | 99 | -> | Plus |
chr2L | 8331223..8331826 | 244..847 | 94 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RB | 1..447 | 183..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RB | 1..447 | 183..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RA | 1..447 | 183..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RB | 1..447 | 183..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RA | 1..447 | 183..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RA | 1..847 | 1..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RA | 1..847 | 1..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RA | 3..849 | 1..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RA | 1..847 | 1..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14275-RA | 3..849 | 1..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8327458..8327583 | 1..126 | 100 | -> | Plus |
2L | 8329648..8329764 | 127..243 | 100 | -> | Plus |
2L | 8332308..8332911 | 244..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8327458..8327583 | 1..126 | 100 | -> | Plus |
2L | 8329648..8329764 | 127..243 | 100 | -> | Plus |
2L | 8332308..8332911 | 244..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8327458..8327583 | 1..126 | 100 | -> | Plus |
2L | 8329648..8329764 | 127..243 | 100 | -> | Plus |
2L | 8332308..8332911 | 244..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8327458..8327583 | 1..126 | 100 | -> | Plus |
arm_2L | 8329648..8329764 | 127..243 | 100 | -> | Plus |
arm_2L | 8332308..8332911 | 244..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8332308..8332911 | 244..847 | 100 | Plus | |
2L | 8327458..8327583 | 1..126 | 100 | -> | Plus |
2L | 8329648..8329764 | 127..243 | 100 | -> | Plus |
Translation from 2 to 628
> RE73208.hyp LHVEFAVDWFYCRWEFKHLKSNKQKLTIEVQQNSKKFQKKKASALEKSTG NLVTAIKNHKMAITTYVYAMCLVLAANLLTVNAIRCHQCNSHDNEDCGGL VVNTPRAQRDNQYLTDCVPPSGEVAFCRKTVINFEQNDERRIERSCGFIP EKIQNACFTADNEGYKQIICTCPDEGCNGASSLLGVRQLGYSLVGSVVSL ALASMLRH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14275-PB | 148 | CG14275-PB | 1..148 | 61..208 | 791 | 100 | Plus |
CG14275-PA | 148 | CG14275-PA | 1..148 | 61..208 | 791 | 100 | Plus |
CG7781-PB | 147 | CG7781-PB | 3..141 | 66..204 | 147 | 29.5 | Plus |
CG7781-PA | 147 | CG7781-PA | 3..141 | 66..204 | 147 | 29.5 | Plus |
Translation from 182 to 628
> RE73208.pep MAITTYVYAMCLVLAANLLTVNAIRCHQCNSHDNEDCGGLVVNTPRAQRD NQYLTDCVPPSGEVAFCRKTVINFEQNDERRIERSCGFIPEKIQNACFTA DNEGYKQIICTCPDEGCNGASSLLGVRQLGYSLVGSVVSLALASMLRH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14635-PA | 148 | GF14635-PA | 1..148 | 1..148 | 556 | 67.6 | Plus |
Dana\GF15263-PA | 147 | GF15263-PA | 3..141 | 6..136 | 137 | 30.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10535-PA | 148 | GG10535-PA | 1..148 | 1..148 | 645 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11591-PA | 145 | GH11591-PA | 3..145 | 4..148 | 408 | 54.8 | Plus |
Dgri\GH10175-PA | 148 | GH10175-PA | 3..131 | 6..130 | 158 | 32.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14275-PB | 148 | CG14275-PB | 1..148 | 1..148 | 791 | 100 | Plus |
CG14275-PA | 148 | CG14275-PA | 1..148 | 1..148 | 791 | 100 | Plus |
CG7781-PB | 147 | CG7781-PB | 3..141 | 6..144 | 147 | 29.5 | Plus |
CG7781-PA | 147 | CG7781-PA | 3..141 | 6..144 | 147 | 29.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17160-PA | 145 | GI17160-PA | 4..117 | 5..118 | 443 | 69.3 | Plus |
Dmoj\GI14231-PA | 148 | GI14231-PA | 3..131 | 6..130 | 149 | 31.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19613-PA | 145 | GL19613-PA | 1..145 | 1..148 | 507 | 61.5 | Plus |
Dper\GL18503-PA | 147 | GL18503-PA | 3..124 | 6..123 | 138 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26031-PA | 145 | GA26031-PA | 1..145 | 1..148 | 507 | 61.5 | Plus |
Dpse\GA20584-PA | 147 | GA20584-PA | 3..124 | 6..123 | 138 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16894-PA | 148 | GM16894-PA | 1..148 | 1..148 | 761 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23524-PA | 148 | GD23524-PA | 1..148 | 1..148 | 779 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17665-PA | 145 | GJ17665-PA | 4..124 | 5..125 | 456 | 68.6 | Plus |
Dvir\GJ20526-PA | 148 | GJ20526-PA | 3..131 | 6..130 | 158 | 32.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23780-PA | 320 | GK23780-PA | 3..131 | 4..132 | 524 | 74.4 | Plus |
Dwil\GK24231-PA | 147 | GK24231-PA | 3..124 | 6..123 | 143 | 31 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18754-PA | 148 | GE18754-PA | 1..148 | 1..148 | 711 | 86.5 | Plus |