Clone RE73208 Report

Search the DGRC for RE73208

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:732
Well:8
Vector:pFlc-1
Associated Gene/TranscriptCG14275-RA
Protein status:RE73208.pep: gold
Preliminary Size:447
Sequenced Size:861

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14275 2002-01-01 Sim4 clustering to Release 2
CG14275 2002-03-28 Blastp of sequenced clone
CG14275 2003-01-01 Sim4 clustering to Release 3
CG14275 2008-04-29 Release 5.5 accounting
CG14275 2008-08-15 Release 5.9 accounting
CG14275 2008-12-18 5.12 accounting

Clone Sequence Records

RE73208.complete Sequence

861 bp (861 high quality bases) assembled on 2002-03-28

GenBank Submission: AY071652

> RE73208.complete
AGTTACACGTTGAATTTGCAGTAGATTGGTTCTACTGTCGGTGGGAATTT
AAACACTTAAAGTCAAACAAACAAAAACTAACAATAGAAGTGCAACAAAA
CAGTAAAAAATTTCAAAAGAAAAAAGCATCAGCGTTGGAGAAGTCTACTG
GAAATCTAGTAACTGCAATCAAAAACCACAAAATGGCAATCACAACCTAC
GTCTATGCCATGTGCCTTGTTTTGGCCGCCAATTTGTTAACAGTGAATGC
CATTCGGTGCCATCAGTGTAATTCGCATGACAACGAGGATTGCGGTGGCC
TGGTGGTGAACACTCCTCGTGCCCAGAGGGACAACCAGTACCTGACGGAC
TGCGTCCCGCCCAGCGGTGAGGTGGCCTTCTGCCGCAAGACGGTGATCAA
TTTCGAGCAGAACGACGAGCGCAGAATCGAGAGAAGCTGTGGTTTCATTC
CGGAGAAGATCCAAAACGCTTGCTTCACCGCCGACAACGAGGGCTACAAG
CAGATCATTTGCACCTGTCCCGACGAGGGATGCAATGGAGCCAGCTCCCT
GCTGGGTGTCCGCCAGTTGGGCTACAGTCTGGTTGGATCTGTCGTCAGTC
TGGCACTGGCCAGCATGCTCAGGCATTAGGTCATCGATCAGCTCACCTTC
AGCTCCTGCATCCTGTTTTCTCCATTCAAAACGTACCTAATCCTAACTGG
TTAAGCTAAGTCTTAAATATTTTGCACTAAGTTCTTTGCTGTTTGCCATA
TTTAGTTATGTATACGTGGCAGCTATTTCGCGTTTAGTCTTGTATTCTGT
ATTTTTATATTTAATTACTATAAAAATATAAGCATCGTATTTAAAAGAAA
AAAAAAAAAAA

RE73208.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14275-RA 943 CG14275-RA 93..942 1..850 4250 100 Plus
CG14275-RB 951 CG14275-RB 223..950 123..850 3640 100 Plus
CG14275.b 790 CG14275.b 69..790 126..847 3610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8331220..8331826 241..847 3005 99.7 Plus
chr2L 23010047 chr2L 8326362..8326487 1..126 630 100 Plus
chr2L 23010047 chr2L 8328551..8328669 125..243 580 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8332305..8332914 241..850 3050 100 Plus
2L 23513712 2L 8327458..8327583 1..126 630 100 Plus
2L 23513712 2L 8329646..8329764 125..243 595 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8332305..8332914 241..850 3050 100 Plus
2L 23513712 2L 8327458..8327583 1..126 630 100 Plus
2L 23513712 2L 8329646..8329764 125..243 595 100 Plus
Blast to na_te.dros performed 2019-03-15 22:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6585..6743 38..195 179 59.4 Plus

RE73208.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:53:31 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8326362..8326487 1..126 100 -> Plus
chr2L 8328553..8328669 127..243 99 -> Plus
chr2L 8331223..8331826 244..847 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:31 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RB 1..447 183..629 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:23:17 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RB 1..447 183..629 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:41 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RA 1..447 183..629 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:42 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RB 1..447 183..629 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:50 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RA 1..447 183..629 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:50:11 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RA 1..847 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:23:17 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RA 1..847 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:41 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RA 3..849 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:42 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RA 1..847 1..847 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:50 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
CG14275-RA 3..849 1..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:31 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8327458..8327583 1..126 100 -> Plus
2L 8329648..8329764 127..243 100 -> Plus
2L 8332308..8332911 244..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:31 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8327458..8327583 1..126 100 -> Plus
2L 8329648..8329764 127..243 100 -> Plus
2L 8332308..8332911 244..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:31 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8327458..8327583 1..126 100 -> Plus
2L 8329648..8329764 127..243 100 -> Plus
2L 8332308..8332911 244..847 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:41 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8327458..8327583 1..126 100 -> Plus
arm_2L 8329648..8329764 127..243 100 -> Plus
arm_2L 8332308..8332911 244..847 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:34 Download gff for RE73208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8332308..8332911 244..847 100   Plus
2L 8327458..8327583 1..126 100 -> Plus
2L 8329648..8329764 127..243 100 -> Plus

RE73208.hyp Sequence

Translation from 2 to 628

> RE73208.hyp
LHVEFAVDWFYCRWEFKHLKSNKQKLTIEVQQNSKKFQKKKASALEKSTG
NLVTAIKNHKMAITTYVYAMCLVLAANLLTVNAIRCHQCNSHDNEDCGGL
VVNTPRAQRDNQYLTDCVPPSGEVAFCRKTVINFEQNDERRIERSCGFIP
EKIQNACFTADNEGYKQIICTCPDEGCNGASSLLGVRQLGYSLVGSVVSL
ALASMLRH*

RE73208.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14275-PB 148 CG14275-PB 1..148 61..208 791 100 Plus
CG14275-PA 148 CG14275-PA 1..148 61..208 791 100 Plus
CG7781-PB 147 CG7781-PB 3..141 66..204 147 29.5 Plus
CG7781-PA 147 CG7781-PA 3..141 66..204 147 29.5 Plus

RE73208.pep Sequence

Translation from 182 to 628

> RE73208.pep
MAITTYVYAMCLVLAANLLTVNAIRCHQCNSHDNEDCGGLVVNTPRAQRD
NQYLTDCVPPSGEVAFCRKTVINFEQNDERRIERSCGFIPEKIQNACFTA
DNEGYKQIICTCPDEGCNGASSLLGVRQLGYSLVGSVVSLALASMLRH*

RE73208.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14635-PA 148 GF14635-PA 1..148 1..148 556 67.6 Plus
Dana\GF15263-PA 147 GF15263-PA 3..141 6..136 137 30.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10535-PA 148 GG10535-PA 1..148 1..148 645 85.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11591-PA 145 GH11591-PA 3..145 4..148 408 54.8 Plus
Dgri\GH10175-PA 148 GH10175-PA 3..131 6..130 158 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14275-PB 148 CG14275-PB 1..148 1..148 791 100 Plus
CG14275-PA 148 CG14275-PA 1..148 1..148 791 100 Plus
CG7781-PB 147 CG7781-PB 3..141 6..144 147 29.5 Plus
CG7781-PA 147 CG7781-PA 3..141 6..144 147 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17160-PA 145 GI17160-PA 4..117 5..118 443 69.3 Plus
Dmoj\GI14231-PA 148 GI14231-PA 3..131 6..130 149 31.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19613-PA 145 GL19613-PA 1..145 1..148 507 61.5 Plus
Dper\GL18503-PA 147 GL18503-PA 3..124 6..123 138 29.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26031-PA 145 GA26031-PA 1..145 1..148 507 61.5 Plus
Dpse\GA20584-PA 147 GA20584-PA 3..124 6..123 138 29.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16894-PA 148 GM16894-PA 1..148 1..148 761 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23524-PA 148 GD23524-PA 1..148 1..148 779 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17665-PA 145 GJ17665-PA 4..124 5..125 456 68.6 Plus
Dvir\GJ20526-PA 148 GJ20526-PA 3..131 6..130 158 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23780-PA 320 GK23780-PA 3..131 4..132 524 74.4 Plus
Dwil\GK24231-PA 147 GK24231-PA 3..124 6..123 143 31 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18754-PA 148 GE18754-PA 1..148 1..148 711 86.5 Plus