Clone RE73235 Report

Search the DGRC for RE73235

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:732
Well:35
Vector:pFlc-1
Associated Gene/TranscriptSelR-RA
Protein status:RE73235.pep: gold
Preliminary Size:1023
Sequenced Size:1042

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6584 2002-01-01 Sim4 clustering to Release 2
CG6584 2002-06-10 Blastp of sequenced clone
CG6584 2003-01-01 Sim4 clustering to Release 3
SelR 2008-04-29 Release 5.5 accounting
SelR 2008-08-15 Release 5.9 accounting
SelR 2008-12-18 5.12 accounting

Clone Sequence Records

RE73235.complete Sequence

1042 bp (1042 high quality bases) assembled on 2002-06-10

GenBank Submission: AY070627

> RE73235.complete
GTTGCCTATCATCCAGCATTCGATTGGCAACGCGAGCCAGCCAGGTGTTT
GATTTTCATCGCGTGCAGCTGTTTTCCCAAGCAGCTTTTTTTGTATTAGT
TTTTAATTTTCCACCGCTGCGTAACATTGCGACGCACGCTTGTTTTCGCC
CGCGTTTGGCGCATTCATAAACAAAAGGCCAAAAATAGAATCAGCACCAT
TTAGAGCGCTATTCAGCAGATTCACGCCAAGACAGCGACAATCCGGACAA
AAGGTATTCCGGACCAGCAGCGACTATGGATAACAAGAGCGAGAAGGTTA
CGGTGAACAAGGAGGAGCTGCGCAAGCGCCTGACCCCGGTGCAGTATCAG
GTTACCCAGGAGGCGGGCACCGAGCGACCCTTCACAGGTTGCTACAACAA
ACACTACGAGAAGGGCGTGTACCAGTGCATCGTGTGCCACCAGGATCTGT
TCAGCTCGGAGACCAAGTACGACTCGGGATGCGGATGGCCGGCCTTCAAC
GATGTCCTAGACAAGGGCAAGGTCACGCTGCACCGCGATGCCAGCATACC
AGAACGTATACGCACTGAGGTCCGCTGCGCCCGCTGCAACGCCCACATGG
GTCACGTCTTCGAGGATGGTCCGAAGCCGACCCGCAAGCGCTACTGCATC
AATTCCGCCTCCATTGAGTTCGTGAACGCGGATCCCGCCACCTCGTCCCC
GCCCGTGGCCACGCCCACCGCGGCGCCCATTGCCCAGCAGTGATGCCGAG
GATCAACCGCCAAACGGAGGAGGCAAGCCTCAGAGTGTCGTTGCTGTTAA
GAAATTTTTCTACGTGTACTTTCTAACTTTCCGCAAATGTGGCCAATTTT
AGCTCGTAGTCAAGTCAATCGCCCCTCTGTTTGTGTAAATAGCTAATGTT
TTGGTTCGAAATTTGTTCGTTAATTTATACAAACCCAAATACCGAATACT
CTGTAACCCCACACATTCAACACAGTACTAATTTTAAAGTGAGCGCGCTA
AATAAACGTGTGTTTTTTACAATAAGAAAAAAAAAAAAAAAA

RE73235.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
SelR-RA 1161 SelR-RA 8..1032 1..1025 5125 100 Plus
SelR-RI 1013 SelR-RI 217..1009 233..1025 3965 100 Plus
SelR-RB 1208 SelR-RB 19..570 1..552 2760 100 Plus
SelR-RB 1208 SelR-RB 600..1076 549..1025 2385 100 Plus
SelR-RI 1013 SelR-RI 1..219 1..219 1095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6688891..6689367 1025..549 2385 100 Minus
chr3R 27901430 chr3R 6693976..6694194 219..1 1095 100 Minus
chr3R 27901430 chr3R 6692344..6692516 389..217 865 100 Minus
chr3R 27901430 chr3R 6692066..6692235 552..383 850 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10863353..10863829 1025..549 2385 100 Minus
3R 32079331 3R 10868439..10868657 219..1 1095 100 Minus
3R 32079331 3R 10866807..10866979 389..217 865 100 Minus
3R 32079331 3R 10866529..10866698 552..383 850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10604184..10604660 1025..549 2385 100 Minus
3R 31820162 3R 10609270..10609488 219..1 1095 100 Minus
3R 31820162 3R 10607638..10607810 389..217 865 100 Minus
3R 31820162 3R 10607360..10607529 552..383 850 100 Minus
3R 31820162 3R 10606387..10606449 623..561 165 84.1 Minus
Blast to na_te.dros performed on 2019-03-16 19:41:12 has no hits.

RE73235.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:42:14 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6688890..6689363 553..1026 99 <- Minus
chr3R 6692066..6692230 388..552 100 <- Minus
chr3R 6692346..6692513 220..387 100 <- Minus
chr3R 6693976..6694194 1..219 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:32 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RC 58..594 207..743 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:01 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RC 58..594 207..743 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:33 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RC 58..594 207..743 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:39:09 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RC 58..594 207..743 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:42 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RA 1..1025 1..1026 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:01 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RA 1..1025 1..1026 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:33 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RA 1..1008 16..1023 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:32 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RA 1..1025 1..1026 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:39:09 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
SelR-RA 1..1008 16..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:14 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10866529..10866693 388..552 100 <- Minus
3R 10866809..10866976 220..387 100 <- Minus
3R 10868439..10868657 1..219 100   Minus
3R 10863352..10863825 553..1026 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:14 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10866529..10866693 388..552 100 <- Minus
3R 10866809..10866976 220..387 100 <- Minus
3R 10868439..10868657 1..219 100   Minus
3R 10863352..10863825 553..1026 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:14 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10866529..10866693 388..552 100 <- Minus
3R 10866809..10866976 220..387 100 <- Minus
3R 10868439..10868657 1..219 100   Minus
3R 10863352..10863825 553..1026 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:33 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6694161..6694379 1..219 100   Minus
arm_3R 6689074..6689547 553..1026 99 <- Minus
arm_3R 6692251..6692415 388..552 100 <- Minus
arm_3R 6692531..6692698 220..387 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:41 Download gff for RE73235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10604183..10604656 553..1026 99 <- Minus
3R 10607360..10607524 388..552 100 <- Minus
3R 10607640..10607807 220..387 100 <- Minus
3R 10609270..10609488 1..219 100   Minus

RE73235.pep Sequence

Translation from 275 to 742

> RE73235.pep
MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQ
CIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPERIRTEVR
CARCNAHMGHVFEDGPKPTRKRYCINSASIEFVNADPATSSPPVATPTAA
PIAQQ*

RE73235.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16176-PA 251 GF16176-PA 42..251 1..155 731 69.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17257-PA 238 GG17257-PA 42..238 1..155 782 77.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18739-PA 200 GH18739-PA 1..200 1..155 678 66.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
SelR-PI 155 CG6584-PI 1..155 1..155 842 100 Plus
SelR-PA 155 CG6584-PA 1..155 1..155 842 100 Plus
SelR-PC 197 CG6584-PC 43..197 1..155 842 100 Plus
SelR-PB 166 CG6584-PB 1..166 1..155 820 93.4 Plus
SelR-PE 208 CG6584-PE 43..208 1..155 820 93.4 Plus
SelR-PH 150 CG6584-PH 1..147 1..141 689 85.7 Plus
SelR-PJ 192 CG6584-PJ 43..189 1..141 689 85.7 Plus
SelR-PG 157 CG6584-PG 1..154 1..141 671 81.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24656-PA 211 GI24656-PA 1..211 1..155 682 64.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12062-PA 205 GL12062-PA 1..205 1..155 667 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19702-PD 156 GA19702-PD 1..156 1..155 732 89.1 Plus
Dpse\GA19702-PE 203 GA19702-PE 37..203 1..155 715 83.2 Plus
Dpse\GA19702-PB 167 GA19702-PB 1..167 1..155 710 83.2 Plus
Dpse\GA19702-PF 148 GA19702-PF 1..141 1..141 666 83 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26142-PA 250 GM26142-PA 43..250 1..155 764 73.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20695-PA 251 GD20695-PA 43..251 1..155 742 72.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24030-PA 200 GJ24030-PA 1..200 1..155 696 68.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13287-PA 209 GK13287-PA 1..138 1..138 662 84.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24659-PA 252 GE24659-PA 45..252 1..155 773 73.6 Plus

RE73235.hyp Sequence

Translation from 275 to 742

> RE73235.hyp
MDNKSEKVTVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQ
CIVCHQDLFSSETKYDSGCGWPAFNDVLDKGKVTLHRDASIPERIRTEVR
CARCNAHMGHVFEDGPKPTRKRYCINSASIEFVNADPATSSPPVATPTAA
PIAQQ*

RE73235.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
SelR-PI 155 CG6584-PI 1..155 1..155 842 100 Plus
SelR-PA 155 CG6584-PA 1..155 1..155 842 100 Plus
SelR-PC 197 CG6584-PC 43..197 1..155 842 100 Plus
SelR-PB 166 CG6584-PB 1..166 1..155 820 93.4 Plus
SelR-PE 208 CG6584-PE 43..208 1..155 820 93.4 Plus