Clone RE73905 Report

Search the DGRC for RE73905

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:739
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG17600-RB
Protein status:RE73905.pep: gold
Preliminary Size:818
Sequenced Size:1031

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17600 2002-01-01 Sim4 clustering to Release 2
CG17600 2002-06-11 Blastp of sequenced clone
CG17600 2003-01-01 Sim4 clustering to Release 3
CG17600 2008-04-29 Release 5.5 accounting
CG17600 2008-08-15 Release 5.9 accounting
CG17600 2008-12-18 5.12 accounting

Clone Sequence Records

RE73905.complete Sequence

1031 bp (1031 high quality bases) assembled on 2002-06-11

GenBank Submission: AY071657

> RE73905.complete
GTTTGCATTTTTATACCCATTTTAATATAATAAAAAAAATCTATAAATGG
GAGTTTGATTTAGACGCAAAGGATATTTATCGTTTCGGTCGGAACATAGT
GAGCTTCGCGACGTGATTATCAAGTCGAATGCTTCGGGAATCGCTCTGGA
CCAACAGAAGGTGGACCAGTACATCAAGGCGATGTCTCTGAATGGCAGTG
AAAAGGTGAACACCGAGAAGCTAGCGGCTATGTGGATGTATGCCACCCAG
ATGGGAAGCCTGCCGCCAACAGTCCGCAAACTGACGCCTCCATCGCGGCA
GATCATGCTCATTCCCTCCACCGCTGGCAATGGGATGGCACCACCACCGC
CCACACGCTTGCCACCTCCGCCTCCGGGCGCCAGAGCTGGACTTCTGCTT
CCCGTGCCCCCGCTGCCGGCGCAGTACCGTGGAATGACCCTTCCCTACAT
GCGACCTGGGCCCGGATCCGTGACCTACGCCCACCCGGCTAGCCTAAGCG
GGACATACCGGACTCACAAGAGCACAAAGTCAGCGGAGATCAATGGGCAG
CGAAGACGGCGGCGGGCGGGAAAGTCTGATGCCAATCGCCGGCAGCGCCG
AAAATCGGAAGCGGATGTCCTGGACGGTGCTCCCAATTTCCAGTATACGG
GTCTAGATCGAGCCATAGCTGATAGCTTTTTGGCCAGGCAAGAACAGTCA
CAGGCGGGCAGTCACGTCGACTATTCGTCGTCTGCCTCCTCGGACTTGTA
CGGCGGTCAGAGGGCATCCTTCAAAACGAAGATCGTTTGCCGGGATGTGG
TGATGTGACGGGAAAAGCATCCGCTCTCTAGTTCCCAGTTTCCCAGACTT
TTGTATATATTTTTTTTACGGAGCCACAACGAAATCCCATCTATGTGGGG
CTTTGTCTGATAAATTACCCCTTTTATATCCATTACTCTATCAATGTACT
TACATATGCGTATAGCTCTTAAGACACATTAAAATTAATCGAATAAAGAT
ATATTAAGCAAACGAAAAAAAAAAAAAAAAA

RE73905.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17600-RB 1016 CG17600-RB 3..1015 1..1013 5065 100 Plus
CG17600.a 996 CG17600.a 69..995 87..1013 4635 100 Plus
CG17600.c 1127 CG17600.c 316..1126 203..1013 4055 100 Plus
CG17600.c 1127 CG17600.c 192..311 88..207 600 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21937310..21937989 334..1013 3400 100 Plus
chrX 22417052 chrX 21936904..21937034 204..334 655 100 Plus
chrX 22417052 chrX 21936725..21936845 87..207 605 100 Plus
chrX 22417052 chrX 21936464..21936552 1..89 445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 22541344..22542023 334..1013 3400 100 Plus
X 23542271 X 22540938..22541068 204..334 655 100 Plus
X 23542271 X 22540759..22540879 87..207 605 100 Plus
X 23542271 X 22540498..22540586 1..89 445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 22526436..22527115 334..1013 3400 100 Plus
X 23527363 X 22526030..22526160 204..334 655 100 Plus
X 23527363 X 22525851..22525971 87..207 605 100 Plus
X 23527363 X 22525590..22525678 1..89 445 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:05:05 has no hits.

RE73905.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:06:00 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21936726..21936843 88..205 100 -> Plus
chrX 21936906..21937034 206..334 100 -> Plus
chrX 21937311..21937989 335..1014 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:53 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RA 1083..1803 88..808 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:48 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RA 1083..1803 88..808 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:05:20 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RA 1083..1803 88..808 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:22 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RA 1083..1803 88..808 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:07 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RA 1083..1803 88..808 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:25 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RB 1..1013 1..1014 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:48 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RB 1..1013 1..1014 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:05:20 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RB 56..1068 1..1014 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:22 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RB 1..1013 1..1014 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:07 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
CG17600-RB 56..1068 1..1014 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:00 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
X 22540760..22540877 88..205 100 -> Plus
X 22540940..22541068 206..334 100 -> Plus
X 22540498..22540584 1..87 100 -> Plus
X 22541345..22542023 335..1014 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:00 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
X 22540760..22540877 88..205 100 -> Plus
X 22540940..22541068 206..334 100 -> Plus
X 22540498..22540584 1..87 100 -> Plus
X 22541345..22542023 335..1014 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:00 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
X 22540760..22540877 88..205 100 -> Plus
X 22540940..22541068 206..334 100 -> Plus
X 22540498..22540584 1..87 100 -> Plus
X 22541345..22542023 335..1014 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:05:20 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21942596..21942713 88..205 100 -> Plus
arm_X 21942776..21942904 206..334 100 -> Plus
arm_X 21942334..21942420 1..87 100 -> Plus
arm_X 21943181..21943859 335..1014 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:28 Download gff for RE73905.complete
Subject Subject Range Query Range Percent Splice Strand
X 22526437..22527115 335..1014 99   Plus
X 22525590..22525676 1..87 100 -> Plus
X 22525852..22525969 88..205 100 -> Plus
X 22526032..22526160 206..334 100 -> Plus

RE73905.pep Sequence

Translation from 181 to 807

> RE73905.pep
MSLNGSEKVNTEKLAAMWMYATQMGSLPPTVRKLTPPSRQIMLIPSTAGN
GMAPPPPTRLPPPPPGARAGLLLPVPPLPAQYRGMTLPYMRPGPGSVTYA
HPASLSGTYRTHKSTKSAEINGQRRRRRAGKSDANRRQRRKSEADVLDGA
PNFQYTGLDRAIADSFLARQEQSQAGSHVDYSSSASSDLYGGQRASFKTK
IVCRDVVM*

RE73905.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21005-PA 257 GF21005-PA 45..257 1..208 811 90.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19751-PA 261 GG19751-PA 57..261 1..208 1028 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24078-PA 221 GH24078-PA 1..221 1..208 601 67.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17600-PC 208 CG17600-PC 1..208 1..208 1083 100 Plus
CG17600-PB 208 CG17600-PB 1..208 1..208 1083 100 Plus
CG17600-PA 600 CG17600-PA 393..600 1..208 1083 100 Plus
CG17600-PD 603 CG17600-PD 393..603 1..208 1069 98.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14476-PA 256 GI14476-PA 59..256 2..208 492 54.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13303-PA 244 GL13303-PA 36..244 1..208 861 92.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22829-PA 248 GA22829-PA 40..248 1..208 860 92.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11737-PA 238 GM11737-PA 35..238 1..208 862 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17551-PA 261 GD17551-PA 42..245 1..208 818 92.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18813-PA 250 GJ18813-PA 38..250 1..208 777 81.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25775-PA 221 GK25775-PA 1..221 1..208 666 77.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17945-PA 240 GE17945-PA 35..240 1..208 882 93.8 Plus

RE73905.hyp Sequence

Translation from 181 to 807

> RE73905.hyp
MSLNGSEKVNTEKLAAMWMYATQMGSLPPTVRKLTPPSRQIMLIPSTAGN
GMAPPPPTRLPPPPPGARAGLLLPVPPLPAQYRGMTLPYMRPGPGSVTYA
HPASLSGTYRTHKSTKSAEINGQRRRRRAGKSDANRRQRRKSEADVLDGA
PNFQYTGLDRAIADSFLARQEQSQAGSHVDYSSSASSDLYGGQRASFKTK
IVCRDVVM*

RE73905.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17600-PC 208 CG17600-PC 1..208 1..208 1083 100 Plus
CG17600-PB 208 CG17600-PB 1..208 1..208 1083 100 Plus
CG17600-PA 600 CG17600-PA 393..600 1..208 1083 100 Plus
CG17600-PD 603 CG17600-PD 393..603 1..208 1069 98.6 Plus