Clone RE73921 Report

Search the DGRC for RE73921

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:739
Well:21
Vector:pFlc-1
Associated Gene/TranscriptCG5010-RA
Protein status:RE73921.pep: gold
Preliminary Size:589
Sequenced Size:976

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5010 2002-01-01 Sim4 clustering to Release 2
CG5010 2002-06-14 Blastp of sequenced clone
CG5010 2003-01-01 Sim4 clustering to Release 3
CG5010 2008-04-29 Release 5.5 accounting
CG5010 2008-08-15 Release 5.9 accounting
CG5010 2008-12-18 5.12 accounting

Clone Sequence Records

RE73921.complete Sequence

976 bp (976 high quality bases) assembled on 2002-06-14

GenBank Submission: AY128487

> RE73921.complete
AATTTCAGTTACTAGCTCGTCATCAAAACAGCAACAACTGTTGAGAATAA
AATTCTTGCGTGAAACCGAATCAATAGAAAAACAAATAAAACAAACAAAA
TGGTTCGCCGTGGACGTTCAGCCAGTCCCCCGCCCTCCACTCGTCGCACC
GCACCTGTGCAGGCCCGTGCCCCCGCCCCGGCCCCGGCTCCTGTCCAGAC
ACGTGCCCCAGCACCGGCCGCCTCTGCCCCTGTTCCGGCGCCCATGAGCG
CTCCTCCCAGTGCCGTCGGCATGCCGGCACCGCAGCAGCCATCGATGTTC
CAGCAGATGGCCGCCACCGCTGGAGGCGTGGCCGTGGGCTCAGCCATTGG
ACACACCGTGGGTCATGGATTGACCTCGCTGTTCAGCGGATCTGGCGACA
AGGAGGCCGCTGCTCCCGCTCCGGCGGCAGCCGCTCCTGCCCCCCAGCAG
CCATACTACGCCCAGCAGCAGCAGCCCAATGAGCCGCAGGGAGCCTGCGC
CTGGGAGCTCAAACAGTTCATCCAGTGCGCCCAGGGTCAGGCGGATCTTA
CCCTCTGCGAGGGATTCAACGAGGCGCTGCGGCAGTGCAAGCAGAGCCAC
CATCTCCAGTAGAGGGCCCAGCTCCGGTAGAATATCATCTGGCCAAGCAC
CGGCGGATGAACGCAGCCGGATGAACCCATCGGATGAACACCTCCGGATG
AACTCTGTCCTATCCCTTCGTTTAGTTCTTAATTGTTTAATTGCAAGCAT
CTGAAAGAAAGCATTGTTTAATTGTAGTGCAAAATGAAATGTTAAATAGA
AAATCCCGTTGGCAGCCCAAAACCCTTTCCAAAAAAAAACACAAACAAAC
AAAACAAAAAAGAAACCAAACCCCACGGGTTGTCAATGTGGGCCAAAACA
AAACGAAGTTTCCAAGAGTTTTTATTGTTTAAAATATAAATATATGCATA
AGTTAATACCAAAAAAAAAAAAAAAA

RE73921.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5010-RA 1111 CG5010-RA 150..1111 1..962 4795 99.8 Plus
CG5010.a 883 CG5010.a 70..881 147..958 4060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17039300..17040112 146..958 4065 100 Plus
chrX 22417052 chrX 17038505..17038650 1..146 730 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17149833..17150649 146..962 4070 99.9 Plus
X 23542271 X 17149038..17149183 1..146 730 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17157931..17158747 146..962 4070 99.8 Plus
X 23527363 X 17157136..17157281 1..146 730 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:26:03 has no hits.

RE73921.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:27:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17038505..17038650 1..146 100 -> Plus
chrX 17039301..17039316 147..162 100 == Plus
chrX 17039398..17040114 244..960 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:54 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..513 100..612 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:20:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..513 100..612 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:52 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..513 100..612 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:11:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..513 100..612 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:19:01 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..513 100..612 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:45:46 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..960 1..960 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:20:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..960 1..960 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:52 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 38..997 1..960 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:11:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 1..960 1..960 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:19:01 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
CG5010-RA 38..997 1..960 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
X 17149038..17149183 1..146 100 -> Plus
X 17149834..17150647 147..960 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
X 17149038..17149183 1..146 100 -> Plus
X 17149834..17150647 147..960 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:06 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
X 17149038..17149183 1..146 100 -> Plus
X 17149834..17150647 147..960 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:52 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17043071..17043216 1..146 100 -> Plus
arm_X 17043867..17044680 147..960 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:43:30 Download gff for RE73921.complete
Subject Subject Range Query Range Percent Splice Strand
X 17157932..17158745 147..960 99   Plus
X 17157136..17157281 1..146 100 -> Plus

RE73921.pep Sequence

Translation from 99 to 611

> RE73921.pep
MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMS
APPSAVGMPAPQQPSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGD
KEAAAPAPAAAAPAPQQPYYAQQQQPNEPQGACAWELKQFIQCAQGQADL
TLCEGFNEALRQCKQSHHLQ*

RE73921.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22321-PA 161 GF22321-PA 48..161 57..170 432 89.5 Plus
Dana\GF23297-PA 182 GF23297-PA 85..182 65..169 173 43.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19099-PA 169 GG19099-PA 1..169 1..170 817 98.2 Plus
Dere\GG11897-PA 114 GG11897-PA 20..114 55..169 153 33.9 Plus
Dere\GG11896-PA 176 GG11896-PA 73..176 67..169 145 42.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12294-PA 160 GH12294-PA 1..160 1..170 474 74.3 Plus
Dgri\GH14350-PA 173 GH14350-PA 57..173 43..169 178 39.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Chchd2-PA 170 CG5010-PA 1..170 1..170 894 100 Plus
Chchd2-PB 122 CG5010-PB 1..122 49..170 648 100 Plus
CG31007-PA 176 CG31007-PA 48..176 42..169 232 37.4 Plus
CG31008-PA 114 CG31008-PA 2..114 37..169 174 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15541-PA 166 GI15541-PA 1..166 1..170 491 78.9 Plus
Dmoj\GI10444-PA 168 GI10444-PA 89..167 81..168 192 41.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15878-PA 161 GL15878-PA 49..161 56..170 441 84.3 Plus
Dper\GL13971-PA 188 GL13971-PA 85..188 65..169 177 43.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18592-PA 161 GA18592-PA 49..161 56..170 439 84.3 Plus
Dpse\GA15932-PA 184 GA15932-PA 81..184 65..169 177 43.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13491-PA 55 GM13491-PA 11..55 126..170 198 82.2 Plus
Dsec\GM12113-PA 176 GM12113-PA 67..176 61..169 147 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17330-PA 113 GD17330-PA 1..113 58..170 575 99.1 Plus
Dsim\GD16686-PA 174 GD16686-PA 67..174 61..169 143 39.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14883-PA 167 GJ14883-PA 1..167 1..170 481 77.2 Plus
Dvir\GJ10660-PA 158 GJ10660-PA 81..158 81..169 177 39.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19777-PA 162 GK19777-PA 1..162 1..170 458 70 Plus
Dwil\GK14164-PA 149 GK14164-PA 53..149 65..169 243 44.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17645-PA 169 GE17645-PA 1..169 1..170 809 97.1 Plus
Dyak\GE23344-PA 114 GE23344-PA 21..114 56..169 154 33.3 Plus
Dyak\GE23343-PA 171 GE23343-PA 73..171 67..169 153 43.5 Plus

RE73921.hyp Sequence

Translation from 99 to 611

> RE73921.hyp
MVRRGRSASPPPSTRRTAPVQARAPAPAPAPVQTRAPAPAASAPVPAPMS
APPSAVGMPAPQQPSMFQQMAATAGGVAVGSAIGHTVGHGLTSLFSGSGD
KEAAAPAPAAAAPAPQQPYYAQQQQPNEPQGACAWELKQFIQCAQGQADL
TLCEGFNEALRQCKQSHHLQ*

RE73921.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5010-PA 170 CG5010-PA 1..170 1..170 894 100 Plus
CG5010-PB 122 CG5010-PB 1..122 49..170 648 100 Plus
CG31007-PA 176 CG31007-PA 48..176 42..169 232 37.4 Plus
CG31008-PA 114 CG31008-PA 2..114 37..169 174 30.8 Plus