Clone RE73934 Report

Search the DGRC for RE73934

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:739
Well:34
Vector:pFlc-1
Associated Gene/TranscriptTaf10-RA
Protein status:RE73934.pep: gold
Sequenced Size:655

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2859 2002-01-01 Sim4 clustering to Release 2
CG2859 2002-05-30 Blastp of sequenced clone
CG2859 2003-01-01 Sim4 clustering to Release 3
Taf10 2008-04-29 Release 5.5 accounting
Taf10 2008-08-15 Release 5.9 accounting
Taf10 2008-12-18 5.12 accounting

Clone Sequence Records

RE73934.complete Sequence

655 bp (655 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118419

> RE73934.complete
ACACACATATACACGCCAGCTGAGATAACAAATTTCTGGAAATAAACAAT
TAAAAAGTGGAAAACAATGGCTTCCGATGGCGAGGACATCAGTGTTACAC
CCGCAGAATCCGTAACATCGGCCACGGACACCGAGGAGGAGGATATAGAC
TCGCCACTAATGCAGTCCGAACTGCATTCCGACGAGGAGCAACCGGACGT
GGAGGAGGTTCCTCTGACGACGGAGGAATCGGAGATGGATGAGCTGATAA
AGCAGCTGGAGGACTACTCGCCCACCATACCAGACGCCCTCACCATGCAC
ATCTTGAAAACGGCTGGCTTCTGCACAGTGGACCCCAAGATAGTGCGCCT
CGTCTCGGTGTCCGCGCAGAAGTTCATCTCGGATATTGCCAACGACGCAC
TGCAGCACTGCAAGACGCGCACCACGAACATCCAGCATTCCAGCGGACAC
AGTTCCAGCAAGGACAAGAAAAACCCCAAGGACAGGAAGTACACGCTGGC
CATGGAGGACCTGGTGCCGGCACTCGCGGACCACGGCATCACCATGCGCA
AGCCGCAGTATTTCGTTTAGATTTAGTTAAGCTCTAAAGTTTTGAATTGG
GCACACAAATATAGCTAGTTTTCTTCAAGTTGTAAAAACAAAAAAAAAAA
AAAAA

RE73934.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-RA 687 Taf10-RA 18..657 1..640 3200 100 Plus
Taf10b-RA 767 Taf10b-RA 1..98 252..155 490 100 Minus
Taf10b-RA 767 Taf10b-RA 98..133 36..1 180 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2767636..2767948 1..313 1550 99.7 Plus
chr2L 23010047 chr2L 2768006..2768333 312..639 1550 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2768285..2768613 312..640 1645 100 Plus
2L 23513712 2L 2767915..2768227 1..313 1565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2768285..2768613 312..640 1645 100 Plus
2L 23513712 2L 2767915..2768227 1..313 1565 100 Plus
Blast to na_te.dros performed 2019-03-16 13:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 4126..4175 147..196 106 68 Plus

RE73934.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:06:03 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2767636..2767947 1..312 99 -> Plus
chr2L 2768007..2768333 313..639 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:55 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 1..504 67..570 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:35:58 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 1..504 67..570 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:06:00 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 1..504 67..570 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:27:31 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 1..504 67..570 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:09:15 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 1..504 67..570 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:07:45 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 4..642 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:35:58 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 14..652 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:06:00 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 26..664 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:27:31 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 4..642 1..639 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:09:15 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 26..664 1..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:03 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767915..2768226 1..312 100 -> Plus
2L 2768286..2768612 313..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:03 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767915..2768226 1..312 100 -> Plus
2L 2768286..2768612 313..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:06:03 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767915..2768226 1..312 100 -> Plus
2L 2768286..2768612 313..639 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:06:00 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2767915..2768226 1..312 100 -> Plus
arm_2L 2768286..2768612 313..639 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:00:03 Download gff for RE73934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767915..2768226 1..312 100 -> Plus
2L 2768286..2768612 313..639 100   Plus

RE73934.hyp Sequence

Translation from 66 to 569

> RE73934.hyp
MASDGEDISVTPAESVTSATDTEEEDIDSPLMQSELHSDEEQPDVEEVPL
TTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSA
QKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLV
PALADHGITMRKPQYFV*

RE73934.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-PA 167 CG2859-PA 1..167 1..167 854 100 Plus
Taf10b-PA 146 CG3069-PA 35..144 51..165 289 53 Plus

RE73934.pep Sequence

Translation from 66 to 569

> RE73934.pep
MASDGEDISVTPAESVTSATDTEEEDIDSPLMQSELHSDEEQPDVEEVPL
TTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSA
QKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLV
PALADHGITMRKPQYFV*

RE73934.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13893-PA 164 GF13893-PA 1..164 1..167 694 79 Plus
Dana\GF13872-PA 148 GF13872-PA 26..146 37..165 292 47.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24883-PA 167 GG24883-PA 1..167 1..167 697 87.4 Plus
Dere\GG24493-PA 146 GG24493-PA 36..144 52..165 293 52.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11693-PA 162 GH11693-PA 1..162 1..167 644 73.4 Plus
Dgri\GH13140-PA 155 GH13140-PA 48..153 55..165 292 52.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-PA 167 CG2859-PA 1..167 1..167 854 100 Plus
Taf10b-PA 146 CG3069-PA 35..144 51..165 289 53 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17138-PA 165 GI17138-PA 1..165 1..167 640 71.9 Plus
Dmoj\GI22891-PA 158 GI22891-PA 51..156 55..165 290 52.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26583-PA 166 GL26583-PA 1..166 1..167 661 76.2 Plus
Dper\GL26445-PA 153 GL26445-PA 43..151 52..165 288 50.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28988-PA 166 GA28988-PA 1..166 1..167 664 74.9 Plus
Dpse\GA15905-PA 153 GA15905-PA 43..151 52..165 288 50.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18365-PA 164 GM18365-PA 1..164 1..167 823 94.6 Plus
Dsec\GM18200-PA 144 GM18200-PA 33..142 51..165 298 53 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23181-PA 167 GD23181-PA 1..167 1..167 853 97 Plus
Dsim\GD22805-PA 144 GD22805-PA 33..142 51..165 298 53 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16180-PA 165 GJ16180-PA 1..165 1..167 652 75.4 Plus
Dvir\GJ23440-PA 158 GJ23440-PA 47..156 51..165 299 53 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24581-PA 173 GK24581-PA 1..173 1..167 585 68.6 Plus
Dwil\GK24479-PA 155 GK24479-PA 38..153 45..165 286 49.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18180-PA 167 GE18180-PA 1..167 1..167 776 86.8 Plus
Dyak\GE15035-PA 148 GE15035-PA 37..146 51..165 297 53 Plus