Clone RE74312 Report

Gene	Date	Evidence
CG7073	2002-11-06	Blastp of sequenced clone
sar1	2008-04-29	Release 5.5 accounting
sar1	2008-08-15	Release 5.9 accounting
sar1	2008-12-18	5.12 accounting

Clone Sequence Records

RE74312.complete Sequence

1512 bp (1512 high quality bases) assembled on 2002-11-06

GenBank Submission: BT001745

> RE74312.complete
TGGTCACACTGGGGCTTATGATAAAAAAAAACTGAACTGACTCCAATAAA
AACGTGAGCCGTCTAGCCCAGCAGCTCTCTTCCCCCCACAATAAACACAC
ACAAGCTGCTCTTGGAGCCAATCACCCGCAACCGATAGCCACACGAAACC
ATCAGGATGTTCATCTGGGACTGGTTCACCGGAGTGCTGGGATACCTGGG
TCTGTGGAAAAAGTCTGGCAAATTATTGTTCCTGGGCCTGGATAATGCTG
GCAAAACCACACTCTTGCATATGCTCAAAGATGATAAGCTGGCGCAGCAT
GTGCCCACACTGCATCCAACATCCGAGGAGCTGTCCATCGGCAACATGCG
CTTCACTACATTCGACTTGGGTGGCCACACTCAGGCACGACGCGTCTGGA
AGGACTACTTCCCTGCTGTGGACGCCATCGTTTTCTTAATAGACGCCTGG
GACCGTGGCCGCTTCCAGGAGAGCAAAAACGAGCTGGATTCGCTGCTCAC
GGATGAGGCGCTGTCCAACTGCCCCGTGCTCATATTGGGCAACAAAATCG
ATAAGCCCGGCGCGGCTAGCGAGGATGAGCTGAGAAACGTGTTCGGACTG
TATCAGCTAACAACCGGCAAGGGCAAAGTTGCACGCGCCGATTTGCCCGG
CCGTCCTCTGGAATTGTTCATGTGCTCCGTGCTGAAGCGACAGGGCTACG
GCGAGGGTTTCCGTTGGCTGGCGCAGTATATCGATTAAGTCAGCATTAGC
AACCACCACCAGCACCATATTTTCAAGAACACCACTCAACACTCAAAACC
GAAAACTTGGCTACAAAATTTCCAAAAATGATTAGAGACCGCAGAAAGAA
CAGAACCCAAGGGATGTGAACCCAGCCCAATTCAAACCGTCAGACCTTAA
GCAAAACGAAGCTGCGTGCGCAATTTCTAATTTATACAAAACAATTACAA
ATATTTCATAATAATAAAAAAAAAAAAACAGAAAACCATACAATGTACAT
CTGTAACACACAAGAAATCGCGGGAAAAACAGAACACAACATCAAAGTGA
AGACAACTTTTCTATCTGGAACATCGGGATACATTGTAAGGAGCTGAAGG
ATGCGCGGAGTGCGCAAGGGAAACTTTTAATAATAATTATGAGTAACAAA
TTATAGCAAATTAAAGGTGATTTATTTAAGAGCATGTGCTTTCAACGAAC
GCTGTTTCGCCAATAAAATGTAGCCACCTACCTTTATTTCAAGTTTATGA
ATTGTAAATGTCGCTATTGATTTCCTAAATAGTTTACTTTGGCCGCAAAA
CATTATGTACATCCCTATAAGGATTCGACCTCCGATAAATGGTACACCTT
AGTTTAGCTAAAAATTTTAAGTTGCATGTCATCGATGTACTTTGTTTCTT
TTATACAATACGAAAGGGAAAGCAATTTATATAAAAAAGCATTTTTGTTT
GCAGACAGAATTCTAAATAAAACGGAGAAAAGTAATTTTGTAAAATAAAA
AAAAAAAAAAAA

RE74312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:36:05

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
sar1.d	1538	sar1.d	92..1532	57..1497	7205	100	Plus
sar1-RE	1585	sar1-RE	124..1563	58..1497	7200	100	Plus
sar1-RB	3017	sar1-RB	1697..2995	199..1497	6495	100	Plus
sar1-RB	3017	sar1-RB	855..999	57..201	725	100	Plus
sar1-RB	3017	sar1-RB	18..75	1..58	275	98.2	Plus
sar1.d	1538	sar1.d	18..75	1..58	275	98.2	Plus
sar1-RE	1585	sar1-RE	18..75	1..58	275	98.2	Plus

Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:17:14

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
chr3R	27901430	chr3R	18183393..18184268	620..1496	4290	99.5	Plus
chr3R	27901430	chr3R	18183085..18183322	385..622	1175	99.6	Plus
chr3R	27901430	chr3R	18181090..18181234	57..201	725	100	Plus
chr3R	27901430	chr3R	18181932..18182052	199..319	590	99.2	Plus
chr3R	27901430	chr3R	18182124..18182189	320..385	330	100	Plus
chr3R	27901430	chr3R	18180251..18180308	1..58	275	98.3	Plus

Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:41 has no hits.

Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:17:12

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3R	32079331	3R	22359835..22360712	620..1497	4390	100	Plus
3R	32079331	3R	22359524..22359761	385..622	1190	100	Plus
3R	32079331	3R	22357529..22357673	57..201	725	100	Plus
3R	32079331	3R	22358371..22358491	199..319	605	100	Plus
3R	32079331	3R	22358563..22358628	320..385	330	100	Plus
3R	32079331	3R	22356692..22356749	1..58	275	98.3	Plus

Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:10:28

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
3R	31820162	3R	22100666..22101543	620..1497	4390	100	Plus
3R	31820162	3R	22100355..22100592	385..622	1190	100	Plus
3R	31820162	3R	22098360..22098504	57..201	725	100	Plus
3R	31820162	3R	22099202..22099322	199..319	605	100	Plus
3R	31820162	3R	22099394..22099459	320..385	330	100	Plus
3R	31820162	3R	22097523..22097580	1..58	275	98.2	Plus

Blast to na_te.dros performed 2019-03-15 20:17:12

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Max-element	8556	Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1).	684..763	928..1006	154	70.7	Plus
Stalker4	7359	Stalker4 STALKER4 7359bp	6788..6844	1476..1421	129	71.9	Minus
Stalker	7256	Stalker STALKER 7256bp	6680..6736	1476..1421	129	71.9	Minus
ZAM	8435	ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1).	1142..1189	939..985	120	75	Plus
ZAM	8435	ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1).	841..881	939..980	117	78.6	Plus

RE74312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:18:12 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
chr3R	18181092..18181232	59..199	100	->	Plus
chr3R	18181933..18182052	200..319	99	->	Plus
chr3R	18182124..18182189	320..385	100	->	Plus
chr3R	18183086..18183321	386..621	99	->	Plus
chr3R	18180251..18180308	1..58	98	->	Plus
chr3R	18183395..18184268	622..1496	96		Plus

Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:37:14 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
sar1-RC	1..582	157..738	100		Plus

Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:07:40 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
sar1-RC	1..582	157..738	100		Plus

Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:05:41 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Sar1-RA	1..582	157..738	100		Plus

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:57:25 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
sar1-RC	1..582	157..738	100		Plus

Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:03 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Sar1-RD	1..582	157..738	100		Plus

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:27:45 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
sar1-RA	18..1513	1..1496	99		Plus

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:07:40 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
sar1-RA	18..1513	1..1496	99		Plus

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:05:41 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Sar1-RA	8..1503	1..1496	99		Plus

Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:57:25 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
sar1-RA	18..1513	1..1496	99		Plus

Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:03 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Sar1-RA	8..1503	1..1496	99		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:12 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3R	22356692..22356749	1..58	98	->	Plus
3R	22357531..22357671	59..199	100	->	Plus
3R	22358372..22358491	200..319	100	->	Plus
3R	22358563..22358628	320..385	100	->	Plus
3R	22359525..22359760	386..621	100	->	Plus
3R	22359837..22360711	622..1496	100		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:12 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3R	22356692..22356749	1..58	98	->	Plus
3R	22357531..22357671	59..199	100	->	Plus
3R	22358372..22358491	200..319	100	->	Plus
3R	22358563..22358628	320..385	100	->	Plus
3R	22359525..22359760	386..621	100	->	Plus
3R	22359837..22360711	622..1496	100		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:12 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3R	22356692..22356749	1..58	98	->	Plus
3R	22357531..22357671	59..199	100	->	Plus
3R	22358372..22358491	200..319	100	->	Plus
3R	22358563..22358628	320..385	100	->	Plus
3R	22359525..22359760	386..621	100	->	Plus
3R	22359837..22360711	622..1496	100		Plus

Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:05:41 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
arm_3R	18182414..18182471	1..58	98	->	Plus
arm_3R	18183253..18183393	59..199	100	->	Plus
arm_3R	18184094..18184213	200..319	100	->	Plus
arm_3R	18184285..18184350	320..385	100	->	Plus
arm_3R	18185247..18185482	386..621	100	->	Plus
arm_3R	18185559..18186433	622..1496	100		Plus

Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:30:01 Download gff for RE74312.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
3R	22100356..22100591	386..621	100	->	Plus
3R	22100668..22101542	622..1496	100		Plus
3R	22097523..22097580	1..58	98	->	Plus
3R	22098362..22098502	59..199	100	->	Plus
3R	22099203..22099322	200..319	100	->	Plus
3R	22099394..22099459	320..385	100	->	Plus

RE74312.pep Sequence

Translation from 156 to 737

> RE74312.pep
MFIWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVP
TLHPTSEELSIGNMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDR
GRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELRNVFGLYQ
LTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYID*

RE74312.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:01:43

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dana\GF18079-PA	193	GF18079-PA	1..193	1..193	1018	100	Plus
Dana\GF24106-PA	180	GF24106-PA	4..174	3..190	274	31.4	Plus
Dana\GF16955-PA	184	GF16955-PA	20..182	18..192	265	33.1	Plus
Dana\GF23416-PA	180	GF23416-PA	15..174	18..189	255	33.3	Plus
Dana\GF23441-PA	182	GF23441-PA	9..148	7..151	246	35.2	Plus

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:01:43

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dere\GG11120-PA	193	GG11120-PA	1..193	1..193	1013	99.5	Plus
Dere\GG15940-PA	190	GG15940-PA	14..184	3..190	272	31.4	Plus
Dere\GG12548-PA	179	GG12548-PA	15..177	18..192	269	33.1	Plus
Dere\GG16407-PA	180	GG16407-PA	15..174	18..189	256	33.9	Plus
Dere\GG13164-PA	182	GG13164-PA	9..148	7..151	246	35.2	Plus

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:01:44

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dgri\GH21130-PA	193	GH21130-PA	1..193	1..193	1012	99	Plus
Dgri\GH14778-PA	180	GH14778-PA	4..174	3..190	274	31.4	Plus
Dgri\GH19902-PA	183	GH19902-PA	19..181	18..192	264	31.4	Plus
Dgri\GH23951-PA	180	GH23951-PA	15..174	18..189	257	33.9	Plus
Dgri\GH18326-PA	186	GH18326-PA	8..180	3..191	248	31.1	Plus

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:30

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Sar1-PE	193	CG7073-PE	1..193	1..193	1031	100	Plus
Sar1-PC	193	CG7073-PC	1..193	1..193	1031	100	Plus
Sar1-PD	193	CG7073-PD	1..193	1..193	1031	100	Plus
Sar1-PA	193	CG7073-PA	1..193	1..193	1031	100	Plus
Arl1-PA	180	CG6025-PA	4..173	3..189	268	31.6	Plus
dnd-PA	179	CG6560-PA	15..175	18..190	262	33.5	Plus
Arf102F-PB	180	CG11027-PB	15..174	18..189	250	33.3	Plus
Arf102F-PA	180	CG11027-PA	15..174	18..189	250	33.3	Plus
Arf79F-PJ	182	CG8385-PJ	9..148	7..151	245	35.2	Plus
Arf79F-PI	182	CG8385-PI	9..148	7..151	245	35.2	Plus
Arf79F-PH	182	CG8385-PH	9..148	7..151	245	35.2	Plus
Arf79F-PF	182	CG8385-PF	9..148	7..151	245	35.2	Plus
Arf79F-PC	182	CG8385-PC	9..148	7..151	245	35.2	Plus
Arf79F-PE	182	CG8385-PE	9..148	7..151	245	35.2	Plus
Arf79F-PB	182	CG8385-PB	9..148	7..151	245	35.2	Plus
Arf79F-PA	182	CG8385-PA	9..148	7..151	245	35.2	Plus
Arl8-PC	186	CG7891-PC	8..143	3..142	242	36.2	Plus
Arl8-PB	186	CG7891-PB	8..143	3..142	242	36.2	Plus
Arl8-PA	186	CG7891-PA	8..143	3..142	242	36.2	Plus
Arl2-PA	184	CG7435-PA	1..155	11..159	237	34.8	Plus
Arf51F-PE	175	CG8156-PE	12..144	19..151	233	33.1	Plus
Arf51F-PA	175	CG8156-PA	12..144	19..151	233	33.1	Plus
Arf51F-PC	175	CG8156-PC	12..144	19..151	233	33.1	Plus
Arf51F-PB	175	CG8156-PB	12..144	19..151	233	33.1	Plus
Arf51F-PD	175	CG8156-PD	12..144	19..151	233	33.1	Plus
Arl5-PA	179	CG7197-PA	8..176	16..192	227	29.8	Plus
CG17819-PA	186	CG17819-PA	23..182	23..193	215	31.4	Plus
Arfrp1-PA	200	CG7039-PA	20..187	23..192	213	32.6	Plus
Arl4-PA	312	CG2219-PA	27..160	23..151	209	38.1	Plus
Arl4-PB	313	CG2219-PB	28..161	23..151	209	38.1	Plus
Arl6-PA	202	CG7735-PA	20..181	23..190	190	31.5	Plus
Arl6-PB	201	CG7735-PB	20..180	23..190	188	31.1	Plus

Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:01:44

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dmoj\GI10474-PA	193	GI10474-PA	1..193	1..193	1011	99	Plus
Dmoj\GI11881-PA	180	GI11881-PA	4..174	3..190	276	31.4	Plus
Dmoj\GI22038-PA	437	GI22038-PA	273..433	18..190	260	31.8	Plus
Dmoj\GI14031-PA	180	GI14031-PA	15..174	18..189	257	33.9	Plus
Dmoj\GI11864-PA	182	GI11864-PA	9..148	7..151	246	35.2	Plus

Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:01:45

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dper\GL23375-PA	193	GL23375-PA	1..193	1..193	1014	99.5	Plus
Dper\GL12747-PA	180	GL12747-PA	4..174	3..190	276	31.4	Plus
Dper\GL23729-PA	182	GL23729-PA	18..180	18..192	266	32	Plus
Dper\GL18404-PA	180	GL18404-PA	15..174	18..189	253	32.8	Plus
Dper\GL25178-PA	182	GL25178-PA	9..148	7..151	246	35.2	Plus

Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:01:45

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dpse\GA20080-PA	193	GA20080-PA	1..193	1..193	1018	100	Plus
Dpse\GA20080-PB	155	GA20080-PB	1..155	39..193	825	100	Plus
Dpse\GA19306-PA	180	GA19306-PA	4..174	3..190	276	31.4	Plus
Dpse\GA19685-PA	182	GA19685-PA	18..180	18..192	266	32	Plus
Dpse\GA10714-PA	180	GA10714-PA	15..174	18..189	253	32.8	Plus

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:01:46

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsec\GM26415-PA	193	GM26415-PA	1..193	1..193	1018	100	Plus
Dsec\GM25571-PA	180	GM25571-PA	4..174	3..190	274	31.4	Plus
Dsec\GM23682-PA	179	GM23682-PA	15..177	18..192	266	33.1	Plus
Dsec\GM13026-PA	180	GM13026-PA	15..174	18..189	254	33.3	Plus
Dsec\GM22073-PA	182	GM22073-PA	9..148	7..151	246	35.2	Plus

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:01:47

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsim\GD20936-PA	193	GD20936-PA	1..193	1..193	1018	100	Plus
Dsim\GD14586-PA	180	GD14586-PA	4..174	3..190	274	31.4	Plus
Dsim\GD18491-PA	179	GD18491-PA	15..177	18..192	266	33.1	Plus
Dsim\GD20493-PA	180	GD20493-PA	15..174	18..189	254	33.3	Plus
Dsim\GD12049-PA	182	GD12049-PA	9..148	7..151	246	35.2	Plus

Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:01:47

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\GJ23156-PA	193	GJ23156-PA	1..193	1..193	1011	99	Plus
Dvir\GJ13575-PA	180	GJ13575-PA	4..174	3..190	276	31.4	Plus
Dvir\GJ24091-PA	179	GJ24091-PA	15..177	18..192	260	31.4	Plus
Dvir\GJ19602-PA	180	GJ19602-PA	15..174	18..189	257	33.9	Plus
Dvir\GJ13559-PA	182	GJ13559-PA	9..148	7..151	246	35.2	Plus

Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:01:48

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dwil\GK14251-PA	193	GK14251-PA	1..193	1..193	1014	99.5	Plus
Dwil\GK24495-PA	167	GK24495-PA	5..160	22..189	267	32.7	Plus
Dwil\GK13011-PA	193	GK13011-PA	30..191	19..192	258	31.6	Plus
Dwil\GK13623-PA	180	GK13623-PA	15..174	18..189	255	33.3	Plus
Dwil\GK20496-PA	182	GK20496-PA	9..148	7..151	246	35.2	Plus

Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:01:48

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dyak\GE10286-PA	193	GE10286-PA	1..193	1..193	1018	100	Plus
Dyak\GE22880-PA	180	GE22880-PA	4..174	3..190	274	31.4	Plus
Dyak\GE24074-PA	179	GE24074-PA	15..177	18..192	269	33.1	Plus
Dyak\Arf102F-PA	180	GE14567-PA	15..174	18..189	247	33.3	Plus
Dyak\GE19486-PA	182	GE19486-PA	9..148	7..151	246	35.2	Plus

RE74312.hyp Sequence

Translation from 156 to 737

> RE74312.hyp
MFIWDWFTGVLGYLGLWKKSGKLLFLGLDNAGKTTLLHMLKDDKLAQHVP
TLHPTSEELSIGNMRFTTFDLGGHTQARRVWKDYFPAVDAIVFLIDAWDR
GRFQESKNELDSLLTDEALSNCPVLILGNKIDKPGAASEDELRNVFGLYQ
LTTGKGKVARADLPGRPLELFMCSVLKRQGYGEGFRWLAQYID*

RE74312.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:26

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Sar1-PE	193	CG7073-PE	1..193	1..193	1031	100	Plus
Sar1-PC	193	CG7073-PC	1..193	1..193	1031	100	Plus
Sar1-PD	193	CG7073-PD	1..193	1..193	1031	100	Plus
Sar1-PA	193	CG7073-PA	1..193	1..193	1031	100	Plus
Arl1-PA	180	CG6025-PA	4..173	3..189	268	31.6	Plus

Library:	RE
Tissue Source:	Drosophila melanogaster embryo
Created by:	Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:	2000-10-23
Comments:	Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:	743
Well:	12
Vector:	pFlc-1
Associated Gene/Transcript	Sar1-RA
Protein status:	RE74312.pep: gold
Sequenced Size:	1512

Clone RE74312 Report

Clone and Library Details

Associated Genes

Clone Sequence Records

RE74312.complete Sequence

RE74312.complete Blast Records

RE74312.complete Sim4 Records

RE74312.pep Sequence

RE74312.pep Blast Records

RE74312.hyp Sequence

RE74312.hyp Blast Records