Clone RE74350 Report

Search the DGRC for RE74350

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:743
Well:50
Vector:pFlc-1
Associated Gene/TranscriptRpL9-RA
Protein status:RE74350.pep: gold
Preliminary Size:1146
Sequenced Size:776

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6141 2002-01-01 Sim4 clustering to Release 2
CG6141 2005-05-17 Blastp of sequenced clone
RpL9 2008-04-29 Release 5.5 accounting
RpL9 2008-08-15 Release 5.9 accounting
RpL9 2008-12-18 5.12 accounting

Clone Sequence Records

RE74350.complete Sequence

776 bp (776 high quality bases) assembled on 2005-05-17

GenBank Submission: BT022718

> RE74350.complete
GCATTTTGTGCGCCTCACACAGCCACATTAAATTTCCCTTCTTTTCTTTT
CCCCGTTTCCGCGAGGAGTCCATCCAGAATTTGTGTCATACAAACGAGGG
ACTAACGGAGCTGTCATCAAGATGCGTACCATTAATTCCAACCAGTGCGT
GAAGATCCCTAAGGATATCAAGGCCTCGGTGAAGGCCCGTGTGGTGACCA
TCACCGGCACCCGCGGCACCCTGAAGCGCAGCTTCAAGCACTTGGCTCTG
GACATGTACATGCCCGACAAGCGCACCCTGAAGGTGGAGAAGTGGTTCGG
AACCAAGAAGGAGTTGGCCGCCGTCCGCACCGTCTGCAGTCACATCGAGA
ACATGATCAAGGGAGTCACGTTTGGATTCCAGTACAAGATGCGTGCTGTG
TACGCCCATTTCCCCATCAACTGTGTCACCTCCGAGAACAACACGGTCAT
TGAGATCCGTAACTTCTTGGGTGAGAAGTACATCCGTCGTGTGGAGATGG
CTCCTGGCGTCACCGTGGTCAACTCCACTGCCCAGAAGGACGAACTTATC
GTGGAGGGAAACGATATTGAGTCTGTCTCCGGATCTGCCGCCCTCATCCA
GCAGTCCACGACCGTCAAGAACAAGGATATCCGTAAGTTCCTTGACGGTC
TGTACGTGTCCGAGAAGACGACCGTTGTGAAGCTAGAGTCTTAGACTTTT
GGAATGTGTTTCAACCTAAAATGTTAATAAAAAAAAACCAACGGCCGAAA
CTTTCAATAAGAAAAAAAAAAAAAAA

RE74350.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
RpL9-RA 948 RpL9-RA 98..861 1..764 3820 100 Plus
RpL9-RB 952 RpL9-RB 162..865 61..764 3520 100 Plus
RpL9-RB 952 RpL9-RB 29..89 1..61 305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11001596..11001995 761..362 2000 100 Minus
chr2L 23010047 chr2L 11002266..11002517 363..112 1260 100 Minus
chr2L 23010047 chr2L 11002885..11002945 61..1 305 100 Minus
chr2L 23010047 chr2L 11002762..11002812 111..61 255 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11002837..11003239 764..362 2015 100 Minus
2L 23513712 2L 11003510..11003761 363..112 1260 100 Minus
2L 23513712 2L 11004129..11004189 61..1 305 100 Minus
2L 23513712 2L 11004006..11004056 111..61 255 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11002837..11003239 764..362 2015 100 Minus
2L 23513712 2L 11003510..11003761 363..112 1260 100 Minus
2L 23513712 2L 11004129..11004189 61..1 305 100 Minus
2L 23513712 2L 11004006..11004056 111..61 255 100 Minus
Blast to na_te.dros performed 2019-03-16 04:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 5391..5458 676..740 107 66.2 Plus

RE74350.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:14:11 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11001596..11001994 363..761 100 <- Minus
chr2L 11002267..11002517 112..362 100 <- Minus
chr2L 11002762..11002811 62..111 100 <- Minus
chr2L 11002885..11002945 1..61 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:37:17 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RB 1..573 122..694 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:27:46 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RB 1..573 122..694 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:45 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RA 1..573 122..694 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:11:45 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RB 1..573 122..694 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:43 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RA 1..573 122..694 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:31:06 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RA 1..761 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:27:46 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RA 1..761 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:45 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RA 1..761 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:11:45 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RA 1..761 1..761 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:43 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
RpL9-RA 1..761 1..761 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:11 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11002840..11003238 363..761 100 <- Minus
2L 11003511..11003761 112..362 100 <- Minus
2L 11004006..11004055 62..111 100 <- Minus
2L 11004129..11004189 1..61 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:11 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11002840..11003238 363..761 100 <- Minus
2L 11003511..11003761 112..362 100 <- Minus
2L 11004006..11004055 62..111 100 <- Minus
2L 11004129..11004189 1..61 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:11 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11002840..11003238 363..761 100 <- Minus
2L 11003511..11003761 112..362 100 <- Minus
2L 11004006..11004055 62..111 100 <- Minus
2L 11004129..11004189 1..61 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:45 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11002840..11003238 363..761 100 <- Minus
arm_2L 11003511..11003761 112..362 100 <- Minus
arm_2L 11004006..11004055 62..111 100 <- Minus
arm_2L 11004129..11004189 1..61 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:48:22 Download gff for RE74350.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11002840..11003238 363..761 100 <- Minus
2L 11003511..11003761 112..362 100 <- Minus
2L 11004006..11004055 62..111 100 <- Minus
2L 11004129..11004189 1..61 100   Minus

RE74350.pep Sequence

Translation from 121 to 693

> RE74350.pep
MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDK
RTLKVEKWFGTKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPIN
CVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIE
SVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVKLES*

RE74350.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14045-PA 190 GF14045-PA 1..190 1..190 983 96.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10334-PA 190 GG10334-PA 1..190 1..190 1000 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10761-PA 190 GH10761-PA 1..190 1..190 976 96.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
RpL9-PC 190 CG6141-PC 1..190 1..190 960 100 Plus
RpL9-PB 190 CG6141-PB 1..190 1..190 960 100 Plus
RpL9-PA 190 CG6141-PA 1..190 1..190 960 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20564-PA 190 GI20564-PA 1..190 1..190 975 96.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23890-PA 190 GL23890-PA 1..190 1..190 991 98.4 Plus
Dper\GL19015-PA 190 GL19015-PA 1..190 1..190 991 98.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19385-PA 190 GA19385-PA 1..190 1..190 991 98.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11214-PA 190 GM11214-PA 1..190 1..190 1007 100 Plus
Dsec\GM15467-PA 111 GM15467-PA 2..87 84..169 434 94.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22204-PA 190 GD22204-PA 1..190 1..190 1007 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13905-PA 190 GJ13905-PA 1..190 1..190 979 96.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14887-PA 190 GK14887-PA 1..190 1..190 976 96.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL9-PA 190 GE13088-PA 1..190 1..190 992 98.9 Plus

RE74350.hyp Sequence

Translation from 121 to 693

> RE74350.hyp
MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDK
RTLKVEKWFGTKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPIN
CVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIE
SVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVKLES*

RE74350.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
RpL9-PC 190 CG6141-PC 1..190 1..190 960 100 Plus
RpL9-PB 190 CG6141-PB 1..190 1..190 960 100 Plus
RpL9-PA 190 CG6141-PA 1..190 1..190 960 100 Plus