Clone RE74472 Report

Search the DGRC for RE74472

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:744
Well:72
Vector:pFlc-1
Associated Gene/TranscriptPcmt-RA
Protein status:RE74472.pep: gold
Sequenced Size:965

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2152 2002-01-01 Sim4 clustering to Release 2
CG2152 2002-11-12 Blastp of sequenced clone
CG2152 2003-01-01 Sim4 clustering to Release 3
Pcmt 2008-04-29 Release 5.5 accounting
Pcmt 2008-08-15 Release 5.9 accounting
Pcmt 2008-12-18 5.12 accounting

Clone Sequence Records

RE74472.complete Sequence

965 bp (965 high quality bases) assembled on 2002-11-12

GenBank Submission: AY075527

> RE74472.complete
AGTGTTATCGTTGGCCCGCCACCTCTGGTACAATATTATAACAAACTAAA
CAAAACAACAAGACGGTGGAAAAAGGGAATCTTGTGGTGCGGATTGGTAA
ACTGGGCTTCTTCTTCCGCGCCTTCAGCATGGCGTGGCGATCCGTGGGAG
CCAATAATGAAGACCTGATTCGCCAACTGAAGGATCACGGCGTCATTGCA
AGTGATGCGGTGGCCCAGGCGATGAAGGAAACCGACCGCAAGCACTACTC
TCCGCGCAACCCCTACATGGACGCCCCGCAACCCATTGGAGGAGGTGTCA
CCATCAGTGCTCCTCACATGCATGCCTTCGCCTTGGAGTATCTACGCGAC
CACTTGAAGCCCGGTGCACGTATACTGGATGTGGGCTCTGGATCTGGCTA
CCTCACAGCCTGCTTCTATCGTTACATCAAGGCTAAGGGCGTTGATGCGG
ACACCCGAATCGTGGGCATAGAGCACCAGGCAGAGCTGGTGCGGCGGAGC
AAGGCCAACTTAAACACCGACGACCGTAGCATGCTGGACTCCGGCCAGTT
GCTGATCGTCGAGGGTGACGGCCGCAAGGGATACCCCCCGAACGCCCCGT
ATAATGCAATCCATGTAGGAGCAGCTGCTCCCGACACACCCACCGAACTC
ATCAACCAACTGGCCAGCGGCGGACGCCTGATAGTTCCAGTCGGTCCCGA
CGGCGGGTCTCAGTACATGCAACAGTACGACAAGGACGCCAATGGGAAGG
TGGAGATGACACGTCTCATGGGCGTAATGTACGTCCCTCTCACGGATCTT
CGCTCCTGACTGCACAGAGTGGGAAGGTCGCTCGTTGCGGTGCTGCTGCT
CGTGTTTTTTTCTCTACCTAATTTTGGCTTACTAGTTAATCAATCAATCA
AAATTAAATTGCTTTTTTTCACGTTGAGTGCAAATATATAAGTTTACCGA
AAAAAAAAAAAAAAA

RE74472.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Pcmt-RA 1215 Pcmt-RA 260..1213 1..955 4705 99.6 Plus
Pcmt.a 996 Pcmt.a 1..725 1..725 3610 99.8 Plus
Pcmt.b 700 Pcmt.b 70..699 321..951 3115 99.8 Plus
Pcmt.a 996 Pcmt.a 771..995 726..951 1090 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1378930..1379335 725..320 2030 100 Minus
chr3R 27901430 chr3R 1378482..1378708 949..722 1090 99.6 Minus
chr3R 27901430 chr3R 1379788..1379970 183..1 900 99.5 Minus
chr3R 27901430 chr3R 1379590..1379727 320..183 690 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5553271..5553676 725..320 2030 100 Minus
3R 32079331 3R 5552817..5553049 955..722 1105 99.1 Minus
3R 32079331 3R 5554129..5554311 183..1 900 99.5 Minus
3R 32079331 3R 5553931..5554068 320..183 690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5294102..5294507 725..320 2030 100 Minus
3R 31820162 3R 5293648..5293880 955..722 1115 99.1 Minus
3R 31820162 3R 5294960..5295142 183..1 900 99.4 Minus
3R 31820162 3R 5294762..5294899 320..183 690 100 Minus
Blast to na_te.dros performed 2019-03-16 04:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 999..1062 20..82 110 65.6 Plus

RE74472.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:14:15 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1378482..1378704 726..949 99 <- Minus
chr3R 1378930..1379334 321..725 100 <- Minus
chr3R 1379590..1379726 184..320 100 <- Minus
chr3R 1379788..1379970 1..183 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:37:20 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..681 129..809 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:04:54 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..681 129..809 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:54 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..681 129..809 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:06 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..681 129..809 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:55 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..681 129..809 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:21 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..948 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:04:54 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..948 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:54 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 6..953 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:07 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 1..948 1..949 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:55 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
Pcmt-RA 6..953 1..949 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:15 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5552823..5553045 726..949 99 <- Minus
3R 5553271..5553675 321..725 100 <- Minus
3R 5553931..5554067 184..320 100 <- Minus
3R 5554129..5554311 1..183 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:15 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5552823..5553045 726..949 99 <- Minus
3R 5553271..5553675 321..725 100 <- Minus
3R 5553931..5554067 184..320 100 <- Minus
3R 5554129..5554311 1..183 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:15 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5552823..5553045 726..949 99 <- Minus
3R 5553271..5553675 321..725 100 <- Minus
3R 5553931..5554067 184..320 100 <- Minus
3R 5554129..5554311 1..183 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:54 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1379653..1379789 184..320 100 <- Minus
arm_3R 1379851..1380033 1..183 99   Minus
arm_3R 1378545..1378767 726..949 99 <- Minus
arm_3R 1378993..1379397 321..725 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:27 Download gff for RE74472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5293654..5293876 726..949 99 <- Minus
3R 5294102..5294506 321..725 100 <- Minus
3R 5294762..5294898 184..320 100 <- Minus
3R 5294960..5295142 1..183 99   Minus

RE74472.pep Sequence

Translation from 128 to 808

> RE74472.pep
MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAP
QPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYI
KAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRK
GYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQY
DKDANGKVEMTRLMGVMYVPLTDLRS*

RE74472.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16041-PA 226 GF16041-PA 1..226 1..226 1053 86.7 Plus
Dana\GF19032-PA 92 GF19032-PA 2..89 124..211 367 79.5 Plus
Dana\GF16034-PA 84 GF16034-PA 2..77 124..199 342 85.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10966-PA 226 GG10966-PA 1..226 1..226 1145 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22401-PA 226 GH22401-PA 1..226 1..226 999 81.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Pcmt-PA 226 CG2152-PA 1..226 1..226 1183 100 Plus
Pcmt-PC 203 CG2152-PC 1..199 1..199 1044 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24486-PA 226 GI24486-PA 1..226 1..226 1024 83.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22157-PA 226 GL22157-PA 1..226 1..226 1059 88.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15271-PA 226 GA15271-PA 1..226 1..226 1063 88.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10623-PA 226 GM10623-PA 1..226 1..226 1178 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19608-PA 227 GD19608-PA 1..208 1..208 1082 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24552-PA 226 GJ24552-PA 1..226 1..226 1046 85.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13781-PA 226 GK13781-PA 1..226 1..226 1047 86.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24165-PA 226 GE24165-PA 1..226 1..226 1163 96.9 Plus

RE74472.hyp Sequence

Translation from 128 to 808

> RE74472.hyp
MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAP
QPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYI
KAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRK
GYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQY
DKDANGKVEMTRLMGVMYVPLTDLRS*

RE74472.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Pcmt-PA 226 CG2152-PA 1..226 1..226 1183 100 Plus
Pcmt-PC 203 CG2152-PC 1..199 1..199 1044 100 Plus