Clone RE74511 Report

Search the DGRC for RE74511

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:745
Well:11
Vector:pFlc-1
Associated Gene/TranscriptRpLP0-RA
Protein status:RE74511.pep: gold
Preliminary Size:1214
Sequenced Size:1277

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7490 2002-01-01 Sim4 clustering to Release 2
CG7490 2002-11-12 Blastp of sequenced clone
CG7490 2003-01-01 Sim4 clustering to Release 3
RpLP0 2008-04-29 Release 5.5 accounting
RpLP0 2008-08-15 Release 5.9 accounting
RpLP0 2008-12-18 5.12 accounting

Clone Sequence Records

RE74511.complete Sequence

1277 bp (1277 high quality bases) assembled on 2002-11-12

GenBank Submission: AY075528

> RE74511.complete
GGTATCTTATTCGCCATCGAAGCGGTCACACTGGGTGCCGCCGCCAACTT
CACTCTTTCCGTTCTGTGAGCGAAAACCGAAAAGTCTGTGCTTTGTTCTT
AAATTCACCCGACGAGTCCCTAATACACAATTAAAATGGTTAGGGAGAAC
AAGGCAGCGTGGAAGGCTCAGTACTTCATCAAGGTTGTGGAACTGTTCGA
TGAGTTCCCAAAGTGCTTCATCGTGGGCGCCGACAACGTGGGCTCCAAGC
AGATGCAGAACATCCGTACCAGCCTGCGTGGACTGGCCGTCGTGCTTATG
GGCAAGAACACCATGATGCGCAAGGCCATCCGCGGTCATCTGGAGAACAA
CCCGCAGCTGGAGAAGCTGCTACCCCACATCAAGGGCAACGTGGGATTCG
TGTTCACCAAGGGCGATCTCGCCGAGGTGCGCGACAAGCTGCTGGAGTCC
AAGGTGCGCGCCCCCGCCCGTCCCGGCGCTATTGCCCCTCTGCACGTCAT
CATCCCGGCGCAGAACACCGGCTTGGGACCCGAGAAGACCAGTTTCTTCC
AGGCCCTGTCCATCCCGACCAAAATTTCCAAGGGAACAATTGAAATCATC
AACGATGTGCCCATCCTGAAGCCTGGCGACAAGGTCGGCGCCTCCGAGGC
GACACTGCTCAACATGTTGAACATCTCGCCCTTCTCGTACGGTCTGATTG
TCAACCAGGTCTACGACTCCGGCTCGATCTTTTCGCCGGAGATCCTGGAC
ATCAAGCCCGAGGATCTGCGCGCCAAGTTCCAACAGGGAGTGGCCAACTT
GGCCGCCGTTTGTTTGTCCGTGGGCTACCCCACCATCGCCTCGGCCCCGC
ACAGCATTGCCAACGGATTCAAGAATCTGCTGGCCATTGCTGCCACCACC
GAGGTGGAGTTCAAGGAGGCGACCACCATCAAGGAGTACATCAAGGACCC
CAGCAAGTTCGCCGCAGCTGCTTCGGCTTCGGCTGCCCCCGCGGCCGGCG
GAGCTACCGAGAAGAAGGAGGAGGCCAAGAAGCCCGAGTCCGAATCAGAG
GAGGAGGACGATGATATGGGTTTCGGTCTGTTCGACTAAGCTGGATCCCG
ATTGCAGAATGCCCTCTGCGGCGCCCGCGAACCATCGCTTCCGCTTTCGG
CGTTTACCCACTAAGACCCTTTGTTATGTTTTCTATGTGCAAATTATTGC
CGCGGTTTGACGGACCCAATGGCGAGTTGCATTAAACATGCTGTAAACTG
CTCGAAAGCGCAAAAAAAAAAAAAAAA

RE74511.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP0.a 1443 RpLP0.a 68..1329 1..1262 6310 100 Plus
RpLP0-RA 1424 RpLP0-RA 49..1310 1..1262 6310 100 Plus
RpLP0.b 1378 RpLP0.b 212..1378 95..1261 5835 100 Plus
RpLP0.b 1378 RpLP0.b 68..162 1..95 475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22065350..22066422 189..1261 5365 100 Plus
chr3L 24539361 chr3L 22065182..22065277 95..190 480 100 Plus
chr3L 24539361 chr3L 22064977..22065071 1..95 475 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22076415..22077488 189..1262 5370 100 Plus
3L 28110227 3L 22076247..22076342 95..190 480 100 Plus
3L 28110227 3L 22076042..22076136 1..95 475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22069515..22070588 189..1262 5370 100 Plus
3L 28103327 3L 22069347..22069442 95..190 480 100 Plus
3L 28103327 3L 22069142..22069236 1..95 475 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:52:37 has no hits.

RE74511.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:53:35 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22064977..22065071 1..95 100 -> Plus
chr3L 22065183..22065276 96..189 100 -> Plus
chr3L 22065351..22066422 190..1261 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:37:21 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..954 136..1089 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:04:57 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..954 136..1089 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:51 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..954 136..1089 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:08 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..954 136..1089 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:56 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..954 136..1089 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:23 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..1261 1..1261 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:04:57 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..1261 1..1261 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:51 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RB 68..1328 1..1261 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:08 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RA 1..1261 1..1261 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:56 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
RpLP0-RB 68..1328 1..1261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:35 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22076042..22076136 1..95 100 -> Plus
3L 22076248..22076341 96..189 100 -> Plus
3L 22076416..22077487 190..1261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:35 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22076042..22076136 1..95 100 -> Plus
3L 22076248..22076341 96..189 100 -> Plus
3L 22076416..22077487 190..1261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:35 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22076042..22076136 1..95 100 -> Plus
3L 22076248..22076341 96..189 100 -> Plus
3L 22076416..22077487 190..1261 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:51 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22069142..22069236 1..95 100 -> Plus
arm_3L 22069348..22069441 96..189 100 -> Plus
arm_3L 22069516..22070587 190..1261 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:30 Download gff for RE74511.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22069516..22070587 190..1261 100   Plus
3L 22069142..22069236 1..95 100 -> Plus
3L 22069348..22069441 96..189 100 -> Plus

RE74511.pep Sequence

Translation from 135 to 1088

> RE74511.pep
MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGL
AVVLMGKNTMMRKAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRD
KLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKG
TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFS
PEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLA
IAATTEVEFKEATTIKEYIKDPSKFAAAASASAAPAAGGATEKKEEAKKP
ESESEEEDDDMGFGLFD*

RE74511.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10946-PA 317 GF10946-PA 1..317 1..317 1638 98.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16244-PA 317 GG16244-PA 1..317 1..317 1639 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14667-PA 318 GH14667-PA 1..318 1..317 1456 95.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP0-PB 317 CG7490-PB 1..317 1..317 1600 100 Plus
RpLP0-PA 317 CG7490-PA 1..317 1..317 1600 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13777-PA 317 GI13777-PA 1..317 1..317 1607 98.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20389-PA 317 GA20389-PA 1..317 1..317 1629 98.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22429-PA 317 GM22429-PA 1..317 1..317 1657 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15019-PA 317 GD15019-PA 1..317 1..317 1657 99.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13582-PA 317 GJ13582-PA 1..317 1..317 1608 96.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20443-PA 317 GK20443-PA 1..317 1..317 1623 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpLP0-PA 317 GE22602-PA 1..317 1..317 1644 99.1 Plus
Dyak\GE21775-PA 254 GE21775-PA 21..221 8..205 148 22.3 Plus

RE74511.hyp Sequence

Translation from 135 to 1088

> RE74511.hyp
MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGL
AVVLMGKNTMMRKAIRGHLENNPQLEKLLPHIKGNVGFVFTKGDLAEVRD
KLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKG
TIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIVNQVYDSGSIFS
PEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLA
IAATTEVEFKEATTIKEYIKDPSKFAAAASASAAPAAGGATEKKEEAKKP
ESESEEEDDDMGFGLFD*

RE74511.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
RpLP0-PB 317 CG7490-PB 1..317 1..317 1600 100 Plus
RpLP0-PA 317 CG7490-PA 1..317 1..317 1600 100 Plus