Clone RE74890 Report

Search the DGRC for RE74890

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:748
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCG14687-RA
Protein status:RE74890.pep: gold
Preliminary Size:417
Sequenced Size:761

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14687 2002-01-01 Sim4 clustering to Release 2
CG14687 2002-06-11 Blastp of sequenced clone
CG14687 2008-04-29 Release 5.5 accounting
CG14687 2008-08-15 Release 5.9 accounting
CG14687 2008-12-18 5.12 accounting

Clone Sequence Records

RE74890.complete Sequence

761 bp (761 high quality bases) assembled on 2002-06-11

GenBank Submission: AY121700

> RE74890.complete
AGTACAATTTTAGATCTCGAGCGAGCGAGTTCGTCCGGAACAGAGAGCTA
CAACCGATGAAAGCCGTATTTGTTGGATAGAAACGCGGACTCAGATTGCC
ATTTTTGTTGCAGTGCACCAGAGGATCATGTACATTTACCCCAGCTCACC
GGAATCAGCATCGTCCTTGCAGTCCGAAGAGAGTGCGGCCATTAAGATTC
AGGCCGGATTTCGTGGCTACCGTGTGCGCAAAGAGATCCATCGATCCAGC
AAGAATCCCCATCCCAGGCGGAATCAGCGACAGCGTCCAAAGAACAACGG
CCTCATGGAAAACCAGAACAATACGGGAAATCCCCGTCCCAGCGGCGAGG
ATCAGCATACGGCCACCGAGAATGGTGGTAAATCCGTGGAGGATCGTAGT
GCCACCAAGATACAGGCGGGATTCCGGGGATTCCTGGTGCGAAAGAAGCA
GAAAATCGCCACCGATGCCGCTGTTAAAATTCAGGCTGGCTTCCGGGGAT
TCAAAACACGCAAAGAATTGAAACAATGCGAGCCCATTGTGTAATGACTT
TGCGCGCTGGTCGTTCCACAACTCTGATTTCTACTGTACATACAAATATT
TGTATTCAAATCCTACCGCTTAGTTCAATACGTGTCGTGTAAATAGATTA
ATATTAACTGATAGCTTCCAGATGAATAAAATACTCTTACTCAAGAAACC
GCAATCTTGAAAGACACCACTATCCATTAACGAGATCCAAAAAAAAAAAA
AAAAAAAAAAA

RE74890.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14687-RA 743 CG14687-RA 1..741 1..741 3705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6618424..6619161 1..738 3675 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10792906..10793646 1..741 3705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10533737..10534477 1..741 3705 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:14:26 has no hits.

RE74890.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:15:30 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6618424..6619161 1..738 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:37:42 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..417 128..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:51 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..417 128..544 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:18 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..417 128..544 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:24 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..417 128..544 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:22 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..417 128..544 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:28 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:51 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:18 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 3..740 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:24 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 1..738 1..738 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:22 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
CG14687-RA 3..740 1..738 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:30 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10792906..10793643 1..738 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:30 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10792906..10793643 1..738 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:30 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10792906..10793643 1..738 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:18 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6618628..6619365 1..738 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:31 Download gff for RE74890.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10533737..10534474 1..738 100   Plus

RE74890.pep Sequence

Translation from 127 to 543

> RE74890.pep
MYIYPSSPESASSLQSEESAAIKIQAGFRGYRVRKEIHRSSKNPHPRRNQ
RQRPKNNGLMENQNNTGNPRPSGEDQHTATENGGKSVEDRSATKIQAGFR
GFLVRKKQKIATDAAVKIQAGFRGFKTRKELKQCEPIV*

RE74890.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17904-PA 149 GF17904-PA 1..149 1..138 549 76.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17705-PA 138 GG17705-PA 1..138 1..138 703 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18060-PA 151 GH18060-PA 1..148 1..133 381 58.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14687-PA 138 CG14687-PA 1..138 1..138 713 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23738-PA 150 GI23738-PA 1..143 1..130 291 57.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21917-PA 145 GL21917-PA 1..144 1..133 423 62.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30167-PA 60 GA30167-PA 1..42 1..42 183 83.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23898-PA 138 GM23898-PA 1..138 1..138 699 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18710-PA 138 GD18710-PA 1..138 1..138 704 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10584-PA 153 GJ10584-PA 1..146 1..130 385 61.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13900-PA 143 GK13900-PA 1..142 1..133 422 64.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26050-PA 138 GE26050-PA 1..138 1..138 694 95.7 Plus

RE74890.hyp Sequence

Translation from 127 to 543

> RE74890.hyp
MYIYPSSPESASSLQSEESAAIKIQAGFRGYRVRKEIHRSSKNPHPRRNQ
RQRPKNNGLMENQNNTGNPRPSGEDQHTATENGGKSVEDRSATKIQAGFR
GFLVRKKQKIATDAAVKIQAGFRGFKTRKELKQCEPIV*

RE74890.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14687-PA 138 CG14687-PA 1..138 1..138 713 100 Plus