BDGP Sequence Production Resources |
Search the DGRC for RH01479
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 14 |
Well: | 79 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL52-RA |
Protein status: | RH01479.pep: gold |
Sequenced Size: | 576 |
Gene | Date | Evidence |
---|---|---|
CG1577 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1577 | 2002-04-21 | Blastp of sequenced clone |
CG1577 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL52 | 2008-04-29 | Release 5.5 accounting |
mRpL52 | 2008-08-15 | Release 5.9 accounting |
mRpL52 | 2008-12-18 | 5.12 accounting |
576 bp (576 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113553
> RH01479.complete GGTTGTTAGGCTTCTTTACCTAATGGTGACAACACTGCAGTCAGCTGTTT GGTTATGTGAACTACGTTTTTTCACAACTACTTTTTAGTTTTCGATAAAT AATGCTGAAAATAACAAAGATCTGCTTGGCCAGCTCCGCCACAAGTACAG CTCAGCGAAGCATTGCTCTTACTGCCCCCCGTGCCATTGATCAGAAGTGG CGTGCAGCCAAGGGATTGCCGGAAAACCCAAATGCCTTTGGCCCACTCAC CAACCTGCCCGACTACACGTACTTAGATGGTAGGCCCACGCCGCTAGGTG CCAACCAGAAGAGGCGCCTGATTAAGCAGCAGGAGATCGCCACCAGGATC GTGGAGCTAAGTGGGGAGCTAGAGTTCGCCAAGCAGCGACATGAACGCCT TAAGGCAAATGCCGAGTCCGAGAAACAGCGCCTCATCCGCAGCAAACTGA AGCCCAAGGGCCACTTCCTGCTCAAGAAATAGCGTCCTAGTCTTAGCCAG TATAAGCTATCATAAGTCACGTAGTGAATGGAGACGAAATTATACGATGG TCTTGTGATGCGAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL52-RA | 666 | mRpL52-RA | 1..563 | 2..564 | 2800 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 3561030..3561290 | 560..300 | 1305 | 100 | Minus |
chr2R | 21145070 | chr2R | 3561350..3561502 | 300..148 | 765 | 100 | Minus |
chr2R | 21145070 | chr2R | 3561562..3561710 | 150..2 | 745 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 3561562..3561710 | 1..150 | 99 | Minus | |
chr2R | 3561028..3561290 | 300..562 | 99 | <- | Minus |
chr2R | 3561351..3561499 | 151..299 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..381 | 102..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..381 | 102..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..381 | 102..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..381 | 102..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..381 | 102..482 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..561 | 2..562 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..561 | 2..562 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..558 | 5..562 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..561 | 2..562 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL52-RA | 1..558 | 5..562 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7673721..7673983 | 300..562 | 99 | <- | Minus |
2R | 7674044..7674192 | 151..299 | 100 | <- | Minus |
2R | 7674255..7674403 | 1..150 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7673721..7673983 | 300..562 | 99 | <- | Minus |
2R | 7674044..7674192 | 151..299 | 100 | <- | Minus |
2R | 7674255..7674403 | 1..150 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7673721..7673983 | 300..562 | 99 | <- | Minus |
2R | 7674044..7674192 | 151..299 | 100 | <- | Minus |
2R | 7674255..7674403 | 1..150 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 3561549..3561697 | 151..299 | 100 | <- | Minus |
arm_2R | 3561226..3561488 | 300..562 | 99 | <- | Minus |
arm_2R | 3561760..3561908 | 1..150 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7675243..7675391 | 151..299 | 100 | <- | Minus |
2R | 7675454..7675602 | 1..150 | 99 | Minus | |
2R | 7674920..7675182 | 300..562 | 99 | <- | Minus |
Translation from 101 to 481
> RH01479.pep MLKITKICLASSATSTAQRSIALTAPRAIDQKWRAAKGLPENPNAFGPLT NLPDYTYLDGRPTPLGANQKRRLIKQQEIATRIVELSGELEFAKQRHERL KANAESEKQRLIRSKLKPKGHFLLKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11701-PA | 128 | GF11701-PA | 1..126 | 1..126 | 544 | 77 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10722-PA | 126 | GG10722-PA | 1..126 | 1..126 | 601 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20015-PA | 127 | GH20015-PA | 1..126 | 1..126 | 499 | 71.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL52-PA | 126 | CG1577-PA | 1..126 | 1..126 | 637 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19194-PA | 127 | GI19194-PA | 1..126 | 1..126 | 515 | 74.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11539-PA | 128 | GL11539-PA | 1..126 | 1..126 | 515 | 74.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13944-PA | 128 | GA13944-PA | 1..126 | 1..126 | 515 | 74.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20769-PA | 126 | GM20769-PA | 1..126 | 1..126 | 604 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10230-PA | 126 | GD10230-PA | 1..126 | 1..126 | 613 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20261-PA | 127 | GJ20261-PA | 1..126 | 1..126 | 518 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19668-PA | 128 | GK19668-PA | 1..127 | 1..126 | 460 | 68 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23728-PA | 126 | GE23728-PA | 1..126 | 1..126 | 605 | 92.9 | Plus |
Translation from 101 to 481
> RH01479.hyp MLKITKICLASSATSTAQRSIALTAPRAIDQKWRAAKGLPENPNAFGPLT NLPDYTYLDGRPTPLGANQKRRLIKQQEIATRIVELSGELEFAKQRHERL KANAESEKQRLIRSKLKPKGHFLLKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL52-PA | 126 | CG1577-PA | 1..126 | 1..126 | 637 | 100 | Plus |