Clone RH01479 Report

Search the DGRC for RH01479

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:14
Well:79
Vector:pFlc-1
Associated Gene/TranscriptmRpL52-RA
Protein status:RH01479.pep: gold
Sequenced Size:576

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1577 2002-01-01 Sim4 clustering to Release 2
CG1577 2002-04-21 Blastp of sequenced clone
CG1577 2003-01-01 Sim4 clustering to Release 3
mRpL52 2008-04-29 Release 5.5 accounting
mRpL52 2008-08-15 Release 5.9 accounting
mRpL52 2008-12-18 5.12 accounting

Clone Sequence Records

RH01479.complete Sequence

576 bp (576 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113553

> RH01479.complete
GGTTGTTAGGCTTCTTTACCTAATGGTGACAACACTGCAGTCAGCTGTTT
GGTTATGTGAACTACGTTTTTTCACAACTACTTTTTAGTTTTCGATAAAT
AATGCTGAAAATAACAAAGATCTGCTTGGCCAGCTCCGCCACAAGTACAG
CTCAGCGAAGCATTGCTCTTACTGCCCCCCGTGCCATTGATCAGAAGTGG
CGTGCAGCCAAGGGATTGCCGGAAAACCCAAATGCCTTTGGCCCACTCAC
CAACCTGCCCGACTACACGTACTTAGATGGTAGGCCCACGCCGCTAGGTG
CCAACCAGAAGAGGCGCCTGATTAAGCAGCAGGAGATCGCCACCAGGATC
GTGGAGCTAAGTGGGGAGCTAGAGTTCGCCAAGCAGCGACATGAACGCCT
TAAGGCAAATGCCGAGTCCGAGAAACAGCGCCTCATCCGCAGCAAACTGA
AGCCCAAGGGCCACTTCCTGCTCAAGAAATAGCGTCCTAGTCTTAGCCAG
TATAAGCTATCATAAGTCACGTAGTGAATGGAGACGAAATTATACGATGG
TCTTGTGATGCGAAAAAAAAAAAAAA

RH01479.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL52-RA 666 mRpL52-RA 1..563 2..564 2800 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3561030..3561290 560..300 1305 100 Minus
chr2R 21145070 chr2R 3561350..3561502 300..148 765 100 Minus
chr2R 21145070 chr2R 3561562..3561710 150..2 745 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7673719..7673983 564..300 1310 99.6 Minus
2R 25286936 2R 7674043..7674195 300..148 765 100 Minus
2R 25286936 2R 7674255..7674403 150..2 745 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7674918..7675182 564..300 1310 99.6 Minus
2R 25260384 2R 7675242..7675394 300..148 765 100 Minus
2R 25260384 2R 7675454..7675602 150..2 745 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:52:41 has no hits.

RH01479.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:53:38 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3561562..3561710 1..150 99   Minus
chr2R 3561028..3561290 300..562 99 <- Minus
chr2R 3561351..3561499 151..299 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:02 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..381 102..482 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:37 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..381 102..482 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:59 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..381 102..482 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:57 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..381 102..482 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:00 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..381 102..482 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:24 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..561 2..562 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:37 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..561 2..562 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:59 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..558 5..562 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:57 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..561 2..562 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:00 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL52-RA 1..558 5..562 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:38 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7673721..7673983 300..562 99 <- Minus
2R 7674044..7674192 151..299 100 <- Minus
2R 7674255..7674403 1..150 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:38 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7673721..7673983 300..562 99 <- Minus
2R 7674044..7674192 151..299 100 <- Minus
2R 7674255..7674403 1..150 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:38 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7673721..7673983 300..562 99 <- Minus
2R 7674044..7674192 151..299 100 <- Minus
2R 7674255..7674403 1..150 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:59 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3561549..3561697 151..299 100 <- Minus
arm_2R 3561226..3561488 300..562 99 <- Minus
arm_2R 3561760..3561908 1..150 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:03 Download gff for RH01479.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7675243..7675391 151..299 100 <- Minus
2R 7675454..7675602 1..150 99   Minus
2R 7674920..7675182 300..562 99 <- Minus

RH01479.pep Sequence

Translation from 101 to 481

> RH01479.pep
MLKITKICLASSATSTAQRSIALTAPRAIDQKWRAAKGLPENPNAFGPLT
NLPDYTYLDGRPTPLGANQKRRLIKQQEIATRIVELSGELEFAKQRHERL
KANAESEKQRLIRSKLKPKGHFLLKK*

RH01479.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11701-PA 128 GF11701-PA 1..126 1..126 544 77 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10722-PA 126 GG10722-PA 1..126 1..126 601 91.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20015-PA 127 GH20015-PA 1..126 1..126 499 71.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL52-PA 126 CG1577-PA 1..126 1..126 637 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19194-PA 127 GI19194-PA 1..126 1..126 515 74.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11539-PA 128 GL11539-PA 1..126 1..126 515 74.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13944-PA 128 GA13944-PA 1..126 1..126 515 74.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20769-PA 126 GM20769-PA 1..126 1..126 604 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10230-PA 126 GD10230-PA 1..126 1..126 613 93.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20261-PA 127 GJ20261-PA 1..126 1..126 518 73.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19668-PA 128 GK19668-PA 1..127 1..126 460 68 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23728-PA 126 GE23728-PA 1..126 1..126 605 92.9 Plus

RH01479.hyp Sequence

Translation from 101 to 481

> RH01479.hyp
MLKITKICLASSATSTAQRSIALTAPRAIDQKWRAAKGLPENPNAFGPLT
NLPDYTYLDGRPTPLGANQKRRLIKQQEIATRIVELSGELEFAKQRHERL
KANAESEKQRLIRSKLKPKGHFLLKK*

RH01479.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL52-PA 126 CG1577-PA 1..126 1..126 637 100 Plus