Clone RH01575 Report

Search the DGRC for RH01575

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:15
Well:75
Vector:pFlc-1
Associated Gene/TranscriptCG6870-RA
Protein status:RH01575.pep: gold
Preliminary Size:740
Sequenced Size:860

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6870 2001-12-13 Blastp of sequenced clone
CG6870 2002-01-01 Sim4 clustering to Release 2
CG6870 2003-01-01 Sim4 clustering to Release 3
CG6870 2008-04-29 Release 5.5 accounting
CG6870 2008-08-15 Release 5.9 accounting
CG6870 2008-12-18 5.12 accounting

Clone Sequence Records

RH01575.complete Sequence

860 bp (860 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070632

> RH01575.complete
GACACTCCAGTACAGGTGGCTGCACACGAAAGACACTCAAGACCCCAAGT
AAAACTGGAACTGAAGCCGACCAAGCAGAACTCAACTTGAATCGATTGCC
GGCTGTCTGAAGTGATCGGGCGGCATTACAAATCGTTGTATCAAATATTA
GTAAAAGTGAAAGTAATTGCATACTTACAACATGTCATCCGCGTTGACGA
ACCTCTTGCAATCGCTGAGAATTGTGCCCTTGGGACATGGAAAGTCCAGT
AATCAGGTGGTCGTTGTACCAAGCAAAAAGGAACGTTTAAAACTGGAAGA
TCTGCCGGAGATCGCATTGGAGGAGGTGGCCCAGCACGACAGCTTCGACG
ATTGCTGGGTGGTAATCTACGATAGGGTCTACGATGTGACACACTTTCTA
AGGGATCATCCCGGCGGCGACGACGTCATTATGGATCACGCAGGGCGAGA
TGCCACCATCGCCTTCCATGGCACAGGACACTCGGGGGATGCCATCGAAA
TGATGAAGGATTTCTTGATCGGTCAACTGCCCACCAAGCAGCACATTTTT
CGCACTGGCAAAAACAAGGTTTTGTCCCTGGGCATACCGGAATAATATAA
TGCCAGCCGATTTTGCACCGATCGCCTTCGCCGCCGTCCTCCATGTCGTA
TATGTCTATATATATATATATTTTTAGAGTATTCATCGACTAGTTTTCTA
GTTGTAATCCGCTTATTTCGAATTCCGCTAAACGGCTTTTGCTTAATCAT
CAAAAACCATACAGACAACTATGTATGTATATTTATATGTTAAATATTTT
TGCCAAGACTTGAAACGGATCTAAGATTATATTATTTTAAATTTGAAAAA
AAAAAAAAAA

RH01575.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6870-RA 852 CG6870-RA 7..852 1..846 4215 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17590089..17590933 845..1 4195 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17591447..17592292 846..1 4215 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17591447..17592292 846..1 4215 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 22:52:44 has no hits.

RH01575.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:53:40 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17590089..17590933 1..845 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:04 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 1..414 182..595 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:29 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 1..414 182..595 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:01 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 1..414 182..595 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:40:36 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 1..414 182..595 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:02 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 1..414 182..595 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:17 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 7..851 1..845 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:29 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 7..851 1..845 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:01 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 8..852 1..845 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:40:36 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 7..851 1..845 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:02 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
CG6870-RA 8..852 1..845 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:40 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17591448..17592292 1..845 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:40 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17591448..17592292 1..845 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:40 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17591448..17592292 1..845 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:01 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17591448..17592292 1..845 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:32 Download gff for RH01575.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17591448..17592292 1..845 99   Minus

RH01575.pep Sequence

Translation from 181 to 594

> RH01575.pep
MSSALTNLLQSLRIVPLGHGKSSNQVVVVPSKKERLKLEDLPEIALEEVA
QHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGH
SGDAIEMMKDFLIGQLPTKQHIFRTGKNKVLSLGIPE*

RH01575.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15091-PA 138 GF15091-PA 1..138 1..137 613 84.8 Plus
Dana\GF13182-PA 134 GF13182-PA 13..81 48..116 214 52.2 Plus
Dana\GF20301-PA 117 GF20301-PA 4..77 43..116 199 47.3 Plus
Dana\GF10319-PA 119 GF10319-PA 7..79 46..116 193 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21732-PA 137 GG21732-PA 1..137 1..137 696 94.9 Plus
Dere\GG23285-PA 134 GG23285-PA 4..81 39..116 213 46.2 Plus
Dere\GG17685-PA 117 GG17685-PA 4..98 43..134 203 46.3 Plus
Dere\GG13493-PA 119 GG13493-PA 7..79 46..116 193 46.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10148-PA 140 GH10148-PA 1..140 1..137 504 66.4 Plus
Dgri\GH20101-PA 134 GH20101-PA 13..81 48..116 216 52.2 Plus
Dgri\GH24801-PA 118 GH24801-PA 5..79 44..118 203 50.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6870-PB 137 CG6870-PB 1..137 1..137 716 100 Plus
CG6870-PA 137 CG6870-PA 1..137 1..137 716 100 Plus
Cyt-b5-PB 134 CG2140-PB 4..81 39..116 206 46.2 Plus
CG3566-PC 89 CG3566-PC 4..77 43..116 205 52.7 Plus
CG3566-PD 106 CG3566-PD 4..77 43..116 205 52.7 Plus
CG3566-PB 117 CG3566-PB 4..77 43..116 205 52.7 Plus
CG5157-PA 119 CG5157-PA 7..79 46..116 177 45.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22344-PA 139 GI22344-PA 1..139 1..137 499 69.8 Plus
Dmoj\GI21528-PA 117 GI21528-PA 4..79 43..118 212 51.3 Plus
Dmoj\GI18997-PA 135 GI18997-PA 13..81 48..116 208 52.2 Plus
Dmoj\GI12677-PA 121 GI12677-PA 22..79 59..116 188 51.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15857-PA 138 GL15857-PA 1..138 1..137 565 79.7 Plus
Dper\GL20014-PA 135 GL20014-PA 13..81 48..116 211 52.2 Plus
Dper\GL21352-PA 118 GL21352-PA 4..79 43..118 193 48.7 Plus
Dper\GL18032-PA 132 GL18032-PA 7..79 46..116 192 46.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19919-PA 138 GA19919-PA 1..138 1..137 560 79 Plus
Dpse\GA15264-PA 135 GA15264-PA 13..81 48..116 211 52.2 Plus
Dpse\GA17524-PA 118 GA17524-PA 4..79 43..118 200 51.3 Plus
Dpse\GA18697-PA 132 GA18697-PA 7..79 46..116 192 46.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17113-PA 137 GM17113-PA 1..137 1..137 722 100 Plus
Dsec\GM20961-PA 134 GM20961-PA 13..81 48..116 211 50.7 Plus
Dsec\GM24442-PA 119 GM24442-PA 7..79 46..116 184 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21856-PA 136 GD21856-PA 1..136 1..137 696 98.5 Plus
Dsim\GD10488-PA 134 GD10488-PA 13..81 48..116 211 50.7 Plus
Dsim\GD12511-PA 119 GD12511-PA 7..79 46..116 188 45.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20242-PA 104 GJ20242-PA 19..104 52..137 392 81.4 Plus
Dvir\GJ19962-PA 135 GJ19962-PA 13..81 48..116 219 53.6 Plus
Dvir\GJ16001-PA 117 GJ16001-PA 4..79 43..118 214 51.3 Plus
Dvir\GJ12661-PA 120 GJ12661-PA 22..79 59..116 182 48.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18221-PA 140 GK18221-PA 3..140 2..137 510 74.8 Plus
Dwil\GK10686-PA 133 GK10686-PA 13..81 48..116 219 52.2 Plus
Dwil\GK19965-PA 118 GK19965-PA 5..80 43..118 191 46.1 Plus
Dwil\GK11351-PA 124 GK11351-PA 7..82 46..118 184 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13120-PA 137 GE13120-PA 1..137 1..137 711 97.8 Plus
Dyak\GE19131-PA 134 GE19131-PA 13..81 48..116 211 50.7 Plus
Dyak\GE16473-PA 117 GE16473-PA 4..98 43..134 206 46.3 Plus
Dyak\GE22584-PA 119 GE22584-PA 7..79 46..116 188 45.2 Plus

RH01575.hyp Sequence

Translation from 181 to 594

> RH01575.hyp
MSSALTNLLQSLRIVPLGHGKSSNQVVVVPSKKERLKLEDLPEIALEEVA
QHDSFDDCWVVIYDRVYDVTHFLRDHPGGDDVIMDHAGRDATIAFHGTGH
SGDAIEMMKDFLIGQLPTKQHIFRTGKNKVLSLGIPE*

RH01575.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6870-PB 137 CG6870-PB 1..137 1..137 716 100 Plus
CG6870-PA 137 CG6870-PA 1..137 1..137 716 100 Plus
CG3566-PC 89 CG3566-PC 4..77 43..116 205 52.7 Plus
CG3566-PD 106 CG3566-PD 4..77 43..116 205 52.7 Plus
CG3566-PB 117 CG3566-PB 4..77 43..116 205 52.7 Plus