Clone RH01578 Report

Search the DGRC for RH01578

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:15
Well:78
Vector:pFlc-1
Associated Gene/TranscriptCpr64Aa-RA
Protein status:RH01578.pep: gold
Preliminary Size:579
Sequenced Size:1031

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15006 2001-12-13 Blastp of sequenced clone
CG15006 2002-01-01 Sim4 clustering to Release 2
CG15006 2003-01-01 Sim4 clustering to Release 3
Cpr64Aa 2008-04-29 Release 5.5 accounting
Cpr64Aa 2008-08-15 Release 5.9 accounting
Cpr64Aa 2008-12-18 5.12 accounting

Clone Sequence Records

RH01578.complete Sequence

1031 bp (1031 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070633

> RH01578.complete
GACAGATCGAGTTCATTTGTCAGTCGAGCAGCAGTAGACCTCCAGTTCTC
CACTACTCCATCGCAAACACCAAGCAATCCGTCCAGAATGGCACAGAAAC
TGATCCTCGTCCTGAGCGCCCTGGTGGCGGTGTCCTCCGCCGTTGTGGTC
CCTGGTCCCGGACTGGCACTGCCCGCCTATCCATCGTACCCGGCGCTGGC
CAAGGTGGCTGCTCCTCTGGTGGCCAAGGTGGCGGGTCCGGAGCCATACG
ATCCCAATCCCCAATACACCTTCAGCTACGATGTTCATGATGGCTCCACT
GGTGACGTGAAGAGCCAGCAGGAGACCCGCAGCGGAGATGTGGTGCAGGG
CGCCTATTCACTGATTGAGGCCGACGGAACCCGCCGCATTGTGGAGTACA
CCGCCGATCCCGTGCACGGATTCAACGCAGTGGTGCGCCGCGAGGGAGCT
GTGGTGAAGGCTGTGGCTCCGGTGGCCAAGGTTCTGGCCCCGGCTCCGCT
GCTCCATGCCTCTCCTCTGGTGGCCAAGGTGCCCGCCTATGGTCCGGCTC
TGGCGCCCGCTTACCCGGCTCTGGCCCACGGATACGGACCGGCTCTGGCT
CCCGCCTATGGACCTGCTCTGCCCAAGCTGGCCCTGCCCGCCCTCTCGCC
CCTGGGCTACCACTAAGTCAGATGGATGGATATACACCACTCGAATAATG
CCGACCTCTTGCCGCAACCGAATAATGGACACATCGCGACCAACTTCTCC
TGCCACCTGGGCTCCAGTTAGCCGGAGCTCATGGGCCGATCATAGTCGAT
AGTAGTTGTAGTATTAGTGGAAATGAAAGCGATTTATCGAAATATGTACA
TACGAATTCACGGACAGCGGATTCCGATTGCCCAGTCCTTGAGTTACGGA
TCCAATGTTCCCTCATCTACACTCACACATTCTCGAGACCTTTCATTTAT
GTTTCTTGTCTTCTTAATCTTAAGGCTGTTTGACCGCGATAAATACTCTA
TAATCCCCAACTCACAAAAAAAAAAAAAAAA

RH01578.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Aa-RA 1322 Cpr64Aa-RA 66..1081 2..1017 5080 100 Plus
Ccp84Ag-RA 1209 Ccp84Ag-RA 263..460 247..444 315 77.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4207224..4207950 1015..289 3635 100 Minus
chr3L 24539361 chr3L 4208277..4208564 289..2 1440 100 Minus
chr3R 27901430 chr3R 2512906..2513103 247..444 315 77.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4207836..4208564 1017..289 3645 100 Minus
3L 28110227 3L 4208891..4209178 289..2 1440 100 Minus
3R 32079331 3R 6687094..6687291 247..444 315 77.3 Plus
3R 32079331 3R 19598126..19598340 438..224 205 73 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4207836..4208564 1017..289 3645 100 Minus
3L 28103327 3L 4208891..4209178 289..2 1440 100 Minus
3R 31820162 3R 6427925..6428122 247..444 315 77.2 Plus
3L 28103327 3L 4212530..4212583 273..220 150 85.1 Minus
Blast to na_te.dros performed on 2019-03-15 14:31:36 has no hits.

RH01578.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:32:22 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4207224..4207950 289..1015 100 <- Minus
chr3L 4208278..4208564 1..288 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:05 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..579 88..666 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:42 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..579 88..666 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:32:59 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..579 88..666 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:41:50 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..579 88..666 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:01:22 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..579 88..666 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:39 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 8..1022 1..1015 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:41 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..1014 2..1015 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:32:59 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..1014 2..1015 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:41:50 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 8..1022 1..1015 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:01:22 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Aa-RA 1..1014 2..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:32:22 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4207838..4208564 289..1015 100 <- Minus
3L 4208892..4209178 1..288 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:32:22 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4207838..4208564 289..1015 100 <- Minus
3L 4208892..4209178 1..288 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:32:22 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4207838..4208564 289..1015 100 <- Minus
3L 4208892..4209178 1..288 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:32:59 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4207838..4208564 289..1015 100 <- Minus
arm_3L 4208892..4209178 1..288 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:47 Download gff for RH01578.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4207838..4208564 289..1015 100 <- Minus
3L 4208892..4209178 1..288 99   Minus

RH01578.hyp Sequence

Translation from 3 to 665

> RH01578.hyp
RSSSFVSRAAVDLQFSTTPSQTPSNPSRMAQKLILVLSALVAVSSAVVVP
GPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTG
DVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAV
VKAVAPVAKVLAPAPLLHASPLVAKVPAYGPALAPAYPALAHGYGPALAP
AYGPALPKLALPALSPLGYH*

RH01578.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:54:46
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Aa-PA 192 CG15006-PA 1..192 29..220 980 100 Plus
Cpr92A-PA 245 CG6240-PA 4..213 34..220 394 45.4 Plus
Ccp84Ag-PA 191 CG2342-PA 1..188 29..215 354 47.1 Plus
Ccp84Ad-PA 199 CG2341-PA 1..177 29..204 341 49.2 Plus
Ccp84Aa-PA 205 CG2360-PA 1..177 29..204 332 48.1 Plus

RH01578.pep Sequence

Translation from 87 to 665

> RH01578.pep
MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAG
PEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRR
IVEYTADPVHGFNAVVRREGAVVKAVAPVAKVLAPAPLLHASPLVAKVPA
YGPALAPAYPALAHGYGPALAPAYGPALPKLALPALSPLGYH*

RH01578.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23877-PA 204 GF23877-PA 1..204 1..192 668 83.7 Plus
Dana\GF18457-PA 246 GF18457-PA 4..135 6..127 308 52.3 Plus
Dana\GF24957-PA 189 GF24957-PA 1..138 1..161 277 44.8 Plus
Dana\GF17800-PA 223 GF17800-PA 1..145 1..137 273 46.7 Plus
Dana\GF21210-PA 141 GF21210-PA 38..136 40..138 269 56.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14209-PA 195 GG14209-PA 1..195 1..192 907 96.9 Plus
Dere\GG15930-PA 245 GG15930-PA 4..131 6..127 317 53.9 Plus
Dere\GG13621-PA 182 GG13621-PA 1..101 1..119 279 52.9 Plus
Dere\GG18788-PA 145 GG18788-PA 49..141 43..134 273 60 Plus
Dere\GG10313-PA 151 GG10313-PA 1..120 1..118 270 51.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15546-PA 200 GH15546-PA 1..200 1..192 523 66.8 Plus
Dgri\GH18126-PA 167 GH18126-PA 34..101 52..119 276 72.1 Plus
Dgri\GH19485-PA 227 GH19485-PA 1..199 1..187 276 43.3 Plus
Dgri\GH22387-PA 235 GH22387-PA 62..135 54..127 275 63.5 Plus
Dgri\GH18128-PA 166 GH18128-PA 59..165 52..140 274 54.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Aa-PA 192 CG15006-PA 1..192 1..192 980 100 Plus
Cpr92A-PA 245 CG6240-PA 4..213 6..192 394 45.4 Plus
Ccp84Ag-PA 191 CG2342-PA 1..188 1..187 354 47.1 Plus
Ccp84Ad-PA 199 CG2341-PA 1..177 1..176 341 49.2 Plus
Ccp84Aa-PA 205 CG2360-PA 1..177 1..176 332 48.1 Plus
Ccp84Ab-PA 221 CG1252-PA 1..177 1..176 327 47.5 Plus
Cpr64Ad-PB 247 CG1259-PB 94..247 11..163 323 52.9 Plus
Ccp84Af-PA 151 CG1331-PA 1..147 1..140 305 50 Plus
Cpr5C-PA 145 CG4052-PA 1..141 1..134 304 52.1 Plus
Edg84A-PA 188 CG2345-PA 17..167 41..192 292 47.1 Plus
Ccp84Ae-PA 208 CG1330-PA 1..147 1..157 292 47.5 Plus
Cpr64Ac-PA 188 CG15008-PA 35..171 2..139 285 48.2 Plus
Cpr62Bc-PB 180 CG1919-PB 7..169 7..177 280 42.1 Plus
Cpr62Bc-PA 180 CG1919-PA 7..169 7..177 280 42.1 Plus
Cpr62Bb-PC 194 CG13935-PC 11..152 36..171 277 49.3 Plus
Cpr62Bb-PB 194 CG13935-PB 11..152 36..171 277 49.3 Plus
Cpr62Bb-PA 194 CG13935-PA 11..152 36..171 277 49.3 Plus
Ccp84Ac-PA 217 CG1327-PA 1..185 1..172 268 42 Plus
Cpr31A-PA 340 CG33302-PA 86..229 20..150 265 49.7 Plus
Cpr30F-PA 146 CG31876-PA 3..138 11..158 264 46.7 Plus
Cpr64Ab-PA 120 CG15007-PA 5..117 4..135 260 45.5 Plus
Crys-PB 477 CG16963-PB 69..136 52..119 240 66.2 Plus
Crys-PA 477 CG16963-PA 69..136 52..119 240 66.2 Plus
CG34461-PB 138 CG34461-PB 2..133 4..149 238 40.4 Plus
CG34461-PA 138 CG34461-PA 2..133 4..149 238 40.4 Plus
Cpr23B-PA 302 CG2973-PA 149..237 51..139 233 55.6 Plus
CG42367-PC 103 CG42367-PC 10..98 5..119 211 44.3 Plus
Cpr76Bb-PA 198 CG9290-PA 74..146 50..120 208 57.5 Plus
Cpr66Cb-PA 162 CG7076-PA 83..151 54..122 202 58 Plus
Cpr30B-PA 153 CG3818-PA 33..124 60..140 198 46.7 Plus
Cpr76Ba-PA 204 CG9283-PA 97..160 57..120 188 56.2 Plus
Cpr76Bc-PD 424 CG9295-PD 49..117 53..121 184 55.1 Plus
Cpr76Bc-PC 424 CG9295-PC 49..117 53..121 184 55.1 Plus
CG13670-PA 266 CG13670-PA 97..163 54..120 177 47.8 Plus
Cpr35B-PA 218 CG3474-PA 66..131 54..119 176 54.5 Plus
Cpr76Bd-PD 1228 CG9299-PD 1076..1219 2..123 176 41 Plus
Cpr76Bd-PB 1228 CG9299-PB 1076..1219 2..123 176 41 Plus
Cpr76Bd-PC 1231 CG9299-PC 1079..1222 2..123 176 41 Plus
Cpr66D-PA 270 CG32029-PA 153..230 55..137 159 39.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16821-PA 193 GI16821-PA 18..193 17..192 534 73.5 Plus
Dmoj\GI14580-PA 193 GI14580-PA 18..193 17..192 534 73.5 Plus
Dmoj\GI23757-PA 176 GI23757-PA 1..173 1..171 305 47.3 Plus
Dmoj\GI23842-PA 176 GI23842-PA 1..173 1..171 305 47.8 Plus
Dmoj\GI23843-PA 227 GI23843-PA 1..177 1..158 282 44.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12729-PA 184 GL12729-PA 27..184 44..192 585 85.4 Plus
Dper\GL21769-PA 198 GL21769-PA 1..101 1..119 274 51.3 Plus
Dper\GL21768-PA 178 GL21768-PA 22..140 45..169 268 50.4 Plus
Dper\GL21770-PA 213 GL21770-PA 44..177 40..158 268 48.5 Plus
Dper\GL22052-PA 151 GL22052-PA 1..120 1..118 264 49.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28205-PA 215 GA28205-PA 1..215 1..192 671 79.1 Plus
Dpse\GA26397-PA 242 GA26397-PA 1..164 1..163 281 45.7 Plus
Dpse\GA15354-PA 198 GA15354-PA 1..101 1..119 274 51.3 Plus
Dpse\GA15355-PA 178 GA15355-PA 22..140 45..169 270 51.2 Plus
Dpse\GA27360-PA 151 GA27360-PA 1..120 1..118 264 49.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13999-PA 195 GM13999-PA 1..195 1..192 913 97.9 Plus
Dsec\GM26903-PA 245 GM26903-PA 4..135 6..127 311 53 Plus
Dsec\GM10909-PA 188 GM10909-PA 22..167 46..192 283 47.3 Plus
Dsec\GM12439-PA 145 GM12439-PA 43..141 37..134 282 58.4 Plus
Dsec\GM10910-PA 191 GM10910-PA 1..101 1..119 273 52.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13280-PA 195 GD13280-PA 1..195 1..192 913 97.9 Plus
Dsim\GD16755-PA 145 GD16755-PA 43..141 37..134 282 58.4 Plus
Dsim\GD19888-PA 188 GD19888-PA 20..167 44..192 279 46 Plus
Dsim\GD19526-PA 236 GD19526-PA 1..142 1..140 278 52.4 Plus
Dsim\GD19890-PA 191 GD19890-PA 1..101 1..119 273 52.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12567-PA 247 GJ12567-PA 87..247 24..192 497 76.4 Plus
Dvir\GJ23938-PA 233 GJ23938-PA 1..182 1..158 292 46 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 45..147 37..140 284 56.2 Plus
Dvir\GJ23300-PA 175 GJ23300-PA 34..101 52..119 268 69.1 Plus
Dvir\GJ21574-PA 146 GJ21574-PA 46..132 59..143 267 58.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10248-PA 206 GK10248-PA 1..206 1..192 523 76.3 Plus
Dwil\GK12249-PA 228 GK12249-PA 1..171 1..184 295 46.8 Plus
Dwil\GK10832-PA 179 GK10832-PA 1..174 1..173 294 48.9 Plus
Dwil\GK13476-PA 245 GK13476-PA 10..143 2..137 289 49.3 Plus
Dwil\GK12247-PA 194 GK12247-PA 1..101 1..119 277 52.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20636-PA 195 GE20636-PA 1..195 1..192 906 96.4 Plus
Dyak\GE25123-PA 498 GE25123-PA 257..388 6..127 310 53 Plus
Dyak\GE25123-PA 498 GE25123-PA 4..133 6..127 305 52.7 Plus
Dyak\GE24878-PA 188 GE24878-PA 23..167 47..192 288 48.3 Plus
Dyak\GE24879-PA 191 GE24879-PA 1..101 1..119 276 52.1 Plus
Dyak\GE25838-PA 151 GE25838-PA 1..120 1..118 270 51.2 Plus