Clone RH01665 Report

Search the DGRC for RH01665

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:16
Well:65
Vector:pFlc-1
Associated Gene/TranscriptCG6426-RA
Protein status:RH01665.pep: gold
Sequenced Size:735

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6426 2001-12-17 Blastp of sequenced clone
CG6426 2002-01-01 Sim4 clustering to Release 2
CG6426 2003-01-01 Sim4 clustering to Release 3
CG6426 2008-04-29 Release 5.5 accounting
CG6426 2008-08-15 Release 5.9 accounting
CG6426 2008-12-18 5.12 accounting

Clone Sequence Records

RH01665.complete Sequence

735 bp (735 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071664

> RH01665.complete
GATTCTCAGCTCAGTTGATCGGGCAGCTCGATAGAGGTCGGTTGTTTACA
GATAGTTGTGATACTGTTCAGTGACTTTTCAAATTGCATTTGCAAACAAA
TATTTTTCGGACACAAGTACTGCTTATAATGGCTGCCAACAAATTGTGCT
GCACTTTGGCTATTGGCGCTCTTTTGTGTCTGGGATTCGCAGCCCTCATT
CAAGCTCAGGATAAGCCGGTGACTGATGTGTGCCTGGGATGCATCTGCGA
GGCCATCAGTGGATGCAACCAGACACGTTACTGCGGCGGCGGAGTCTGCG
GCCTGTTTCGCATCACCTGGGCATATTGGGCCGACGGCGGCAAGCTGACC
TTGGGCAACGAGAGTCCCCAGTCGGAGGATGCGTATGCCAATTGCGTGAA
CGATCCCTACTGCGCGGCCAACACGATCCAGAATTACATGACCAAGTTCG
GCCAGGACTGCAATGGAGACAACGCCATCGATTGCTACGACTTTGCTGCC
ATCCACAAGCTGGGCGGCTATGGATGCAAGGGCGAGCTGAGCTACCAGTA
CCAGACGCAGCTGACCAACTGCCTTAATTCGTTCCAGCAGATCGACGTGC
GCTCTAGCATATAAACACATTAACTTGCTAAATTTATATTGTAATTAAAT
TTAAATAATGTAATAATTAATTATTTATGGCAATGCATTTGAATTCGATT
CAGGATAAATGACAATACAAGCAAAAAAAAAAAAA

RH01665.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG6426-RA 799 CG6426-RA 17..736 6..725 3585 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12758682..12759020 384..722 1650 99.1 Plus
chr2R 21145070 chr2R 12756575..12756779 6..210 1025 100 Plus
chr2R 21145070 chr2R 12758438..12758609 210..381 860 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16871510..16871854 381..725 1710 99.7 Plus
2R 25286936 2R 16869398..16869602 6..210 1025 100 Plus
2R 25286936 2R 16871269..16871440 210..381 860 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16872709..16873053 381..725 1710 99.7 Plus
2R 25260384 2R 16870597..16870801 6..210 1025 100 Plus
2R 25260384 2R 16872468..16872639 210..381 860 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:26:30 has no hits.

RH01665.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:27:21 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12756569..12756779 1..210 98 -> Plus
chr2R 12758439..12758609 211..381 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:09 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..486 129..614 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:25 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..486 129..614 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:11 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..486 129..614 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:04 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..486 129..614 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:19:34 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..486 129..614 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:23 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..723 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:25 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..723 1..722 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:11 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..713 10..722 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:04 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..723 1..722 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:19:34 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
CG6426-RA 1..713 10..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:21 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16869392..16869602 1..210 98 -> Plus
2R 16871270..16871440 211..381 100 -> Plus
2R 16871511..16871851 382..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:21 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16869392..16869602 1..210 98 -> Plus
2R 16871270..16871440 211..381 100 -> Plus
2R 16871511..16871851 382..722 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:21 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16869392..16869602 1..210 98 -> Plus
2R 16871270..16871440 211..381 100 -> Plus
2R 16871511..16871851 382..722 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:11 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12759016..12759356 382..722 99   Plus
arm_2R 12756897..12757107 1..210 98 -> Plus
arm_2R 12758775..12758945 211..381 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:29 Download gff for RH01665.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16870591..16870801 1..210 98 -> Plus
2R 16872469..16872639 211..381 100 -> Plus
2R 16872710..16873050 382..722 99   Plus

RH01665.pep Sequence

Translation from 128 to 613

> RH01665.pep
MAANKLCCTLAIGALLCLGFAALIQAQDKPVTDVCLGCICEAISGCNQTR
YCGGGVCGLFRITWAYWADGGKLTLGNESPQSEDAYANCVNDPYCAANTI
QNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGCKGELSYQYQTQLTNCLN
SFQQIDVRSSI*

RH01665.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11417-PA 161 GF11417-PA 1..160 1..160 801 94.4 Plus
Dana\GF11420-PA 166 GF11420-PA 22..151 25..154 420 55.4 Plus
Dana\GF11418-PA 161 GF11418-PA 28..148 28..145 418 62 Plus
Dana\GF11419-PA 158 GF11419-PA 9..156 15..160 407 51.4 Plus
Dana\GF25005-PA 264 GF25005-PA 140..249 29..139 174 33 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20638-PA 161 GG20638-PA 1..160 1..160 830 99.4 Plus
Dere\GG20639-PA 161 GG20639-PA 17..156 21..153 429 53.6 Plus
Dere\GG20642-PA 163 GG20642-PA 19..149 25..155 416 55.7 Plus
Dere\GG20641-PA 159 GG20641-PA 20..155 24..158 397 50 Plus
Dere\GG14400-PA 264 GG14400-PA 165..259 57..150 146 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22644-PA 161 GH22644-PA 1..160 1..160 725 84.4 Plus
Dgri\GH22645-PA 163 GH22645-PA 28..157 28..154 451 56.9 Plus
Dgri\GH22647-PA 157 GH22647-PA 20..151 28..160 405 55.6 Plus
Dgri\GH22646-PA 117 GH22646-PA 1..116 39..154 343 49.1 Plus
Dgri\GH15386-PA 226 GH15386-PA 107..203 29..133 173 34.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6426-PA 161 CG6426-PA 1..161 1..161 894 100 Plus
CG6421-PA 161 CG6421-PA 11..156 15..153 448 52.7 Plus
CG6435-PA 163 CG6435-PA 19..149 25..155 438 55.7 Plus
CG6429-PA 159 CG6429-PA 20..157 24..160 425 49.3 Plus
CG14823-PA 263 CG14823-PA 164..257 57..149 162 34.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21157-PA 190 GI21157-PA 1..185 1..161 534 54.6 Plus
Dmoj\GI21158-PA 158 GI21158-PA 10..152 12..154 443 49.7 Plus
Dmoj\GI21159-PA 145 GI21159-PA 6..129 22..149 377 55.5 Plus
Dmoj\GI12991-PA 230 GI12991-PA 114..225 35..150 184 30.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11564-PA 161 GL11564-PA 1..159 1..159 761 89.9 Plus
Dper\GL11565-PA 161 GL11565-PA 2..156 9..153 465 54.8 Plus
Dper\GL11566-PA 156 GL11566-PA 1..143 1..149 393 50 Plus
Dper\GL11567-PA 132 GL11567-PA 1..112 43..154 356 58 Plus
Dper\GL25021-PA 254 GL25021-PA 135..254 35..158 189 35.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:14:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19584-PA 161 GA19584-PA 1..159 1..159 761 89.9 Plus
Dpse\GA19580-PA 161 GA19580-PA 2..156 9..153 464 54.8 Plus
Dpse\GA19586-PA 156 GA19586-PA 11..143 15..149 389 50.7 Plus
Dpse\GA19591-PA 132 GA19591-PA 1..112 43..154 359 58.9 Plus
Dpse\GA13274-PA 254 GA13274-PA 135..231 35..134 181 38.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21731-PA 161 GM21731-PA 1..160 1..160 834 99.4 Plus
Dsec\GM21736-PA 163 GM21736-PA 19..155 25..161 421 54 Plus
Dsec\GM21734-PA 159 GM21734-PA 20..155 24..158 402 50.7 Plus
Dsec\GM21732-PA 91 GM21732-PA 28..85 28..82 197 63.8 Plus
Dsec\GM21733-PA 55 GM21733-PA 1..50 104..153 151 46 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11227-PA 161 GD11227-PA 28..156 28..153 427 56.6 Plus
Dsim\GD11230-PA 163 GD11230-PA 18..149 24..155 421 55.3 Plus
Dsim\GD11229-PA 159 GD11229-PA 20..155 24..158 393 49.3 Plus
Dsim\GD11226-PA 63 GD11226-PA 1..37 1..37 179 94.6 Plus
Dsim\GD13989-PA 263 GD13989-PA 164..258 57..150 159 34 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:14:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21009-PA 161 GJ21009-PA 1..160 1..160 757 87.5 Plus
Dvir\GJ21008-PA 161 GJ21008-PA 1..158 1..158 655 75.9 Plus
Dvir\GJ21007-PA 145 GJ21007-PA 1..143 16..158 598 75.5 Plus
Dvir\GJ21010-PA 161 GJ21010-PA 28..155 28..152 446 59.4 Plus
Dvir\GJ21012-PA 154 GJ21012-PA 1..149 12..160 407 51 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:14:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22025-PA 161 GK22025-PA 1..160 1..160 741 86.2 Plus
Dwil\GK22026-PA 166 GK22026-PA 12..157 15..153 459 57.5 Plus
Dwil\GK22028-PA 172 GK22028-PA 28..155 22..149 381 49.2 Plus
Dwil\GK22027-PA 163 GK22027-PA 12..155 10..154 371 47.6 Plus
Dwil\GK16648-PA 274 GK16648-PA 151..255 25..133 164 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11827-PA 161 GE11827-PA 1..160 1..160 833 99.4 Plus
Dyak\GE11828-PA 159 GE11828-PA 15..154 21..153 433 55 Plus
Dyak\GE11830-PA 164 GE11830-PA 19..149 25..155 421 55.7 Plus
Dyak\GE11829-PA 159 GE11829-PA 20..155 24..158 399 50 Plus
Dyak\GE21589-PA 262 GE21589-PA 163..257 57..150 149 33 Plus

RH01665.hyp Sequence

Translation from 128 to 613

> RH01665.hyp
MAANKLCCTLAIGALLCLGFAALIQAQDKPVTDVCLGCICEAISGCNQTR
YCGGGVCGLFRITWAYWADGGKLTLGNESPQSEDAYANCVNDPYCAANTI
QNYMTKFGQDCNGDNAIDCYDFAAIHKLGGYGCKGELSYQYQTQLTNCLN
SFQQIDVRSSI*

RH01665.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6426-PA 161 CG6426-PA 1..161 1..161 894 100 Plus
CG6421-PA 161 CG6421-PA 11..156 15..153 448 52.7 Plus
CG6435-PA 163 CG6435-PA 19..149 25..155 438 55.7 Plus
CG6429-PA 159 CG6429-PA 20..157 24..160 425 49.3 Plus
CG14823-PA 263 CG14823-PA 164..257 57..149 162 34.4 Plus