Clone RH01747 Report

Search the DGRC for RH01747

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:17
Well:47
Vector:pFlc-1
Associated Gene/TranscriptCG2837-RA
Protein status:RH01747.pep: gold
Sequenced Size:1028

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2837 2001-12-13 Blastp of sequenced clone
CG2837 2002-01-01 Sim4 clustering to Release 2
CG2837 2003-01-01 Sim4 clustering to Release 3
CG2837 2008-04-29 Release 5.5 accounting
CG2837 2008-08-15 Release 5.9 accounting
CG2837 2008-12-18 5.12 accounting

Clone Sequence Records

RH01747.complete Sequence

1028 bp (1028 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070636

> RH01747.complete
GTCAGTTGCCTTGCAGACGCGCAGCGGACAAGTTGTTACTGGAGATACGT
TTCTGCGGCTCCACATAAATGCTGACTGCTGCTGCTGGCCATGATGTCTT
GGCCAAAACAATGGGGCTTCGCTAGCCTCTGGCTGCCCGTGCTGATCGGC
CTGCTCCACACACAAAATGCATCAGCTTTTATTGTGCCCCGGGAACTGCC
CTCCATCTTATCCATAGTTTACTCCAATATACCACCGATTAAAAAGGGAA
CTGATTCCCGTTTGGGCTTTGGCTTTCGCCTGGGCGAGCATGCGGACTTT
CAGGTGATGGTGGAACTGGGTCCCCAGAAGGAGACGCGTCCCATCGGCGA
GCCCAACCAGGATGATCAATCGTTCAACAAGCGCCAGGTGAGCCAGAGCG
ATCAGAAGGCTCTGGCCCGTCAACTTTATCGCCAGCAGGTGATGGAGGAG
GCGGAGAGATTGATGACGTCCACGGAGAGGAATGGGGCCAGCTGGCTGCA
GGCCTGGTCGAATGGCATGAAACCGCAGAAGCCCAAATCAAAGGATCAGG
CCAAGAAACCAGTGAAAGAAAGTTCTTCAAGCAATTATCAGAATGCACAG
GCAACAGATCCCACCAGTGCCATGAAGCAGCTGCAGTTGCTCTACAAAAT
GGCCACCAGTTCGAGCACCACAACCACCACAACAGTGCCTCCTGTCTTTA
CAGGAGGATCCCTTAATTTGGGTGGTCCAAGTGGCTTTAAGCTGCCACCT
CCTGCTCTTAGCCAGGATACCAATACGCTGAGCAATCCTGATCCTCTCAA
GAGCAAATCTGAGATCACCAAGGAGCTTATGGATGTCAGTCTGGAGACGG
ACACTTAGGTTGTGCGCTTATCTAGTTACTAATTAACCTCTATATACAAA
TACTTGTGTATTTGGGTGCTTAGCAAATCTGTGTGTAGTATGGCTTAGCT
ATCTTTTGTAAATAATATTATAAATAAAACTTAATTTAGTGAATCGCTTT
ATTGAACAGCCCGAAAAAAAAAAAAAAA

RH01747.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG2837-RB 1294 CG2837-RB 176..1189 2..1015 5055 99.9 Plus
CG2837-RC 1309 CG2837-RC 239..1204 50..1015 4815 99.8 Plus
CG2837-RA 1344 CG2837-RA 274..1239 50..1015 4815 99.8 Plus
CG2837-RC 1309 CG2837-RC 176..223 2..49 240 100 Plus
CG2837-RA 1344 CG2837-RA 176..223 2..49 240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4903200..4903964 1011..247 3795 99.7 Minus
chr2L 23010047 chr2L 4904883..4904994 160..49 560 100 Minus
chr2L 23010047 chr2L 4904022..4904109 248..161 440 100 Minus
chr2L 23010047 chr2L 4905844..4905891 49..2 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4904066..4904834 1015..247 3830 99.9 Minus
2L 23513712 2L 4905753..4905864 160..49 560 100 Minus
2L 23513712 2L 4904892..4904979 248..161 440 100 Minus
2L 23513712 2L 4906714..4906761 49..2 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4904066..4904834 1015..247 3830 99.8 Minus
2L 23513712 2L 4905753..4905864 160..49 560 100 Minus
2L 23513712 2L 4904892..4904979 248..161 440 100 Minus
2L 23513712 2L 4906714..4906761 49..2 240 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:16:59 has no hits.

RH01747.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:17:53 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4903198..4903963 248..1013 95 <- Minus
chr2L 4904023..4904109 161..247 100 <- Minus
chr2L 4904883..4904993 50..160 100 <- Minus
chr2L 4905844..4905891 1..49 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:12 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RC 1..768 91..858 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:21 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RC 1..768 91..858 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:07:37 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RB 1..768 91..858 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:26 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RC 1..768 91..858 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:17 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RB 1..768 91..858 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:32 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RB 1..1012 2..1013 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:20 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RB 1..1012 2..1013 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:07:37 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RB 2..1011 2..1011 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:27 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RB 1..1012 2..1013 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:17 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
CG2837-RB 2..1011 2..1011 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:53 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4904068..4904833 248..1013 99 <- Minus
2L 4904893..4904979 161..247 100 <- Minus
2L 4905753..4905863 50..160 100 <- Minus
2L 4906714..4906761 1..49 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:53 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4904068..4904833 248..1013 99 <- Minus
2L 4904893..4904979 161..247 100 <- Minus
2L 4905753..4905863 50..160 100 <- Minus
2L 4906714..4906761 1..49 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:53 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4904068..4904833 248..1013 99 <- Minus
2L 4904893..4904979 161..247 100 <- Minus
2L 4905753..4905863 50..160 100 <- Minus
2L 4906714..4906761 1..49 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:07:37 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4905753..4905863 50..160 100 <- Minus
arm_2L 4906714..4906761 1..49 97   Minus
arm_2L 4904068..4904833 248..1013 99 <- Minus
arm_2L 4904893..4904979 161..247 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:31 Download gff for RH01747.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4904068..4904833 248..1013 99 <- Minus
2L 4904893..4904979 161..247 100 <- Minus
2L 4905753..4905863 50..160 100 <- Minus
2L 4906714..4906761 1..49 97   Minus

RH01747.hyp Sequence

Translation from 90 to 857

> RH01747.hyp
MMSWPKQWGFASLWLPVLIGLLHTQNASAFIVPRELPSILSIVYSNIPPI
KKGTDSRLGFGFRLGEHADFQVMVELGPQKETRPIGEPNQDDQSFNKRQV
SQSDQKALARQLYRQQVMEEAERLMTSTERNGASWLQAWSNGMKPQKPKS
KDQAKKPVKESSSSNYQNAQATDPTSAMKQLQLLYKMATSSSTTTTTTVP
PVFTGGSLNLGGPSGFKLPPPALSQDTNTLSNPDPLKSKSEITKELMDVS
LETDT*

RH01747.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG2837-PD 255 CG2837-PD 1..255 1..255 1318 100 Plus
CG2837-PC 255 CG2837-PC 1..255 1..255 1318 100 Plus
CG2837-PB 255 CG2837-PB 1..255 1..255 1318 100 Plus
CG2837-PA 255 CG2837-PA 1..255 1..255 1318 100 Plus

RH01747.pep Sequence

Translation from 90 to 857

> RH01747.pep
MMSWPKQWGFASLWLPVLIGLLHTQNASAFIVPRELPSILSIVYSNIPPI
KKGTDSRLGFGFRLGEHADFQVMVELGPQKETRPIGEPNQDDQSFNKRQV
SQSDQKALARQLYRQQVMEEAERLMTSTERNGASWLQAWSNGMKPQKPKS
KDQAKKPVKESSSSNYQNAQATDPTSAMKQLQLLYKMATSSSTTTTTTVP
PVFTGGSLNLGGPSGFKLPPPALSQDTNTLSNPDPLKSKSEITKELMDVS
LETDT*

RH01747.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21548-PA 240 GF21548-PA 1..240 2..255 910 76 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24344-PA 255 GG24344-PA 1..255 1..255 1200 91.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10105-PA 243 GH10105-PA 27..242 25..252 521 57.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
snsl-PD 255 CG2837-PD 1..255 1..255 1318 100 Plus
snsl-PC 255 CG2837-PC 1..255 1..255 1318 100 Plus
snsl-PB 255 CG2837-PB 1..255 1..255 1318 100 Plus
snsl-PA 255 CG2837-PA 1..255 1..255 1318 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14421-PA 244 GI14421-PA 1..243 2..252 638 54.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19494-PA 255 GL19494-PA 1..252 2..253 854 72.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15478-PA 255 GA15478-PA 1..252 2..253 860 73.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18064-PA 255 GM18064-PA 1..255 1..255 1304 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22682-PA 255 GD22682-PA 1..255 1..255 1310 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16263-PA 236 GJ16263-PA 1..235 2..252 629 55.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24591-PA 252 GK24591-PA 25..252 23..255 658 63.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18722-PA 254 GE18722-PA 1..254 2..255 1137 92.9 Plus