Clone RH01814 Report

Search the DGRC for RH01814

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:18
Well:14
Vector:pFlc-1
Associated Gene/TranscriptRpL18-RA
Protein status:RH01814.pep: gold
Preliminary Size:703
Sequenced Size:737

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8615 2002-01-01 Sim4 clustering to Release 2
CG8615 2002-04-21 Blastp of sequenced clone
CG8615 2003-01-01 Sim4 clustering to Release 3
RpL18 2008-04-29 Release 5.5 accounting
RpL18 2008-08-15 Release 5.9 accounting
RpL18 2008-12-18 5.12 accounting

Clone Sequence Records

RH01814.complete Sequence

737 bp (737 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113554

> RH01814.complete
TTGCTTTCTTTTGGCTTTCGTTTCCGGCGAGCGTTGATTAATACATTCAA
CAGAAGAAATGGGTATTGATATCAACCACAAGTACGATCGCAAGGTTCGC
AGAACCGAGCCCAAATCCCAGGATGTGTACCTGCGCCTGCTGGTCAAGCT
GTACCGCTTCCTTCAGCGCCGCACCAACAAGAAGTTCAACCGCATCATCC
TGAAGCGTTTGTTCATGAGCAAGATCAACAGGCCGCCGCTATCGCTTCAG
CGCATCGCTCGCTTCTTCAAGGCCGCCAACCAGCCGGAGTCTACCATCGT
GGTCGTCGGCACCGTCACCGACGATGCCCGCCTCCTGGTGGTGCCCAAGC
TCACCGTGTGCGCCCTGCACGTCACGCAGACCGCCAGGGAGCGCATCCTG
AAGGCCGGCGGTGAGGTCCTGACCTTCGATCAACTGGCTCTCCGATCGCC
CACCGGCAAGAACACGCTGCTGCTGCAGGGCAGGCGTACCGCCCGCACCG
CCTGCAAGCACTTCGGCAAGGCTCCCGGTGTGCCCCACTCGCACACCCGC
CCCTATGTCCGCTCTAAGGGACGCAAGTTCGAGCGTGCTCGTGGTCGTCG
CTCCAGCTGCGGCTACAAGAAGTAAGCGACTGGCTGACTGGACTGGATTC
GGCATCCTTTTGGTTAAGATAATGATTTTTCTCGCCATCGCACGGCAATA
AAAGAGTTTTATTCCAAAAGGCGAAAAAAAAAAAAAA

RH01814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpL18-RA 782 RpL18-RA 54..782 4..732 3615 99.7 Plus
RpL18.a 765 RpL18.a 63..765 30..732 3485 99.7 Plus
BHD-RA 1565 BHD-RA 1506..1565 732..673 270 96.6 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7232365..7232939 721..147 2875 100 Minus
chr3L 24539361 chr3L 7233015..7233102 148..61 440 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7240194..7240779 732..147 2900 99.7 Minus
3L 28110227 3L 7240855..7240942 148..61 440 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7233294..7233879 732..147 2900 99.6 Minus
3L 28103327 3L 7233955..7234042 148..61 440 100 Minus
3L 28103327 3L 7234325..7234357 62..30 165 100 Minus
3L 28103327 3L 7234420..7234447 31..4 140 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:36:04 has no hits.

RH01814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:36:57 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7232363..7232937 149..723 99 <- Minus
chr3L 7233015..7233101 62..148 100 <- Minus
chr3L 7233386..7233415 32..61 100 <- Minus
chr3L 7233480..7233509 1..31 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:13 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:38 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:19:06 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:58 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:16 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..567 59..625 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:25 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..722 2..723 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:38 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..722 2..723 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:19:06 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 2..724 1..723 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:58 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 1..722 2..723 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:16 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
RpL18-RA 2..724 1..723 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:57 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7240203..7240777 149..723 99 <- Minus
3L 7240855..7240941 62..148 100 <- Minus
3L 7241226..7241255 32..61 100 <- Minus
3L 7241320..7241349 1..31 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:57 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7240203..7240777 149..723 99 <- Minus
3L 7240855..7240941 62..148 100 <- Minus
3L 7241226..7241255 32..61 100 <- Minus
3L 7241320..7241349 1..31 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:36:57 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7240203..7240777 149..723 99 <- Minus
3L 7240855..7240941 62..148 100 <- Minus
3L 7241226..7241255 32..61 100 <- Minus
3L 7241320..7241349 1..31 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:19:06 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7233303..7233877 149..723 99 <- Minus
arm_3L 7233955..7234041 62..148 100 <- Minus
arm_3L 7234326..7234355 32..61 100 <- Minus
arm_3L 7234420..7234449 1..31 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:04 Download gff for RH01814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7233303..7233877 149..723 99 <- Minus
3L 7233955..7234041 62..148 100 <- Minus
3L 7234326..7234355 32..61 100 <- Minus
3L 7234420..7234449 1..31 96   Minus

RH01814.pep Sequence

Translation from 58 to 624

> RH01814.pep
MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKR
LFMSKINRPPLSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTV
CALHVTQTARERILKAGGEVLTFDQLALRSPTGKNTLLLQGRRTARTACK
HFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYKK*

RH01814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24783-PA 188 GF24783-PA 1..188 1..188 969 97.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14989-PA 188 GG14989-PA 1..188 1..188 972 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15152-PA 190 GH15152-PA 3..190 1..188 896 95.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
RpL18-PB 188 CG8615-PB 1..188 1..188 963 100 Plus
RpL18-PC 188 CG8615-PC 1..188 1..188 963 100 Plus
RpL18-PA 188 CG8615-PA 1..188 1..188 963 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12089-PA 189 GI12089-PA 2..189 1..188 900 94.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24902-PA 189 GL24902-PA 3..189 2..188 966 97.9 Plus
Dper\GL13213-PA 187 GL13213-PA 1..187 1..188 878 94.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21210-PA 189 GA21210-PA 3..189 2..188 966 97.9 Plus
Dpse\GA27760-PA 135 GA27760-PA 1..135 53..188 611 92.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13785-PA 188 GM13785-PA 1..188 1..188 977 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13082-PA 169 GD13082-PA 1..169 1..188 792 85.1 Plus
Dsim\GD15528-PA 86 GD15528-PA 20..86 108..174 208 61.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13360-PA 188 GJ13360-PA 1..188 1..188 960 96.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13159-PA 188 GK13159-PA 1..188 1..188 958 97.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20435-PA 188 GE20435-PA 1..188 1..188 976 98.9 Plus

RH01814.hyp Sequence

Translation from 58 to 624

> RH01814.hyp
MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKR
LFMSKINRPPLSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTV
CALHVTQTARERILKAGGEVLTFDQLALRSPTGKNTLLLQGRRTARTACK
HFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYKK*

RH01814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
RpL18-PB 188 CG8615-PB 1..188 1..188 963 100 Plus
RpL18-PC 188 CG8615-PC 1..188 1..188 963 100 Plus
RpL18-PA 188 CG8615-PA 1..188 1..188 963 100 Plus