BDGP Sequence Production Resources |
Search the DGRC for RH02160
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 21 |
Well: | 60 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Tsp42En-RA |
Protein status: | RH02160.pep: gold |
Preliminary Size: | 657 |
Sequenced Size: | 959 |
Gene | Date | Evidence |
---|---|---|
CG12839 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12839 | 2002-12-11 | Blastp of sequenced clone |
CG12839 | 2003-01-01 | Sim4 clustering to Release 3 |
Tsp42En | 2008-04-29 | Release 5.5 accounting |
Tsp42En | 2008-08-15 | Release 5.9 accounting |
Tsp42En | 2008-12-18 | 5.12 accounting |
959 bp (959 high quality bases) assembled on 2002-12-11
GenBank Submission: AY071666
> RH02160.complete GAGTCGCACGTCAACCTCTATGCCAATAGGGCTGGCGGATTTCATTGGGT CTTCGCTTCTCCGGTGGTCGACGCTTCGGGTCAAGTGCGCAGCGGAAAAT TGGTGCGGGAACAAGGATAAACGCACCTTCGTGGTTAATTATAGGGATTA TTGATTGGCAACATGGACTGCCGCACATCGTTCCTGAAAGCCGTTCTTAT CGTTCTCAATGTGCTGCTATCGCTGATTGGAGTGACGTTGATTGCTCTGT CCGTGTACGAGCTGAACAGCTCCACGCCGGGCACCTTCGAGCACATCGCC ATCGTTGTCCAGATCTTCGTGGGCACCTTCGTGGTCCTGACCTCGTTTCT GGGCTGCTTTGCCACCGCTCGGGTTTCCCTGGGACTGGTTTGGAGCTATG TGATCTGCCTGCTGATCCTGCTGTGCCTGCAGATTTATATTATCGCGGCA GCCCACTCCACGGACTACGTGGAGCGATCCAAGAAGGATTTCCTGGCCAC CTGGGCTGATCAAAGGACCAATGTGGAGCGCATATCGCTCCTTGAGCAAA AGTACTCCTGCTGCGGCCAGTTGGGCGCCCATGACTACATCCTGATGGGA CGGGGTATACCCTTGAGCTGCTACAAGGATCAGGAGCGGCGCGAGTACAG CCTCTTCTCCGGGGGCTGCCTGCAGGCCGTGCAGGCGCATGCCACGGACA ACGTGGCCATCGGACTCATCATCAAGTGGCTGCTGCTTCTGGTGGAGTTC GCCGCCCTGGGAGCCGCAACCCACTTGGGCATCACGGTGCGCAATAAATT GCGGCGCGAAAGATTCTAACAGGTCGCTTGGAATCATCGAAATCGGGTGT TGGCAACGCATAATCCGATATCTATGGATTTTTATAGCAGTTTAAGATGA TCTGGAGGCAACAGAAGCGTAGAATAAAAAATAAACCAAAATCACAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42En-RA | 1432 | Tsp42En-RA | 135..1077 | 2..944 | 4715 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 2940180..2940400 | 2..222 | 1090 | 99.5 | Plus |
chr2R | 21145070 | chr2R | 2941251..2941449 | 746..944 | 995 | 100 | Plus |
chr2R | 21145070 | chr2R | 2940930..2941126 | 551..747 | 985 | 100 | Plus |
chr2R | 21145070 | chr2R | 2940467..2940641 | 222..396 | 875 | 100 | Plus |
chr2R | 21145070 | chr2R | 2940706..2940861 | 397..552 | 780 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 7052775..7052995 | 2..222 | 1105 | 100 | Plus |
2R | 25286936 | 2R | 7053846..7054044 | 746..944 | 995 | 100 | Plus |
2R | 25286936 | 2R | 7053525..7053721 | 551..747 | 985 | 100 | Plus |
2R | 25286936 | 2R | 7053062..7053236 | 222..396 | 875 | 100 | Plus |
2R | 25286936 | 2R | 7053301..7053456 | 397..552 | 780 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 7053974..7054194 | 2..222 | 1105 | 100 | Plus |
2R | 25260384 | 2R | 7055045..7055243 | 746..944 | 995 | 100 | Plus |
2R | 25260384 | 2R | 7054724..7054920 | 551..747 | 985 | 100 | Plus |
2R | 25260384 | 2R | 7054261..7054435 | 222..396 | 875 | 100 | Plus |
2R | 25260384 | 2R | 7054500..7054655 | 397..552 | 780 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 2941253..2941449 | 748..945 | 99 | Plus | |
chr2R | 2940468..2940641 | 223..396 | 100 | -> | Plus |
chr2R | 2940706..2940861 | 397..552 | 100 | -> | Plus |
chr2R | 2940932..2941126 | 553..747 | 100 | -> | Plus |
chr2R | 2940179..2940400 | 1..222 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 1..657 | 163..819 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 1..657 | 163..819 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 1..657 | 163..819 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 1..657 | 163..819 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 1..657 | 163..819 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 2..925 | 2..925 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 2..925 | 2..925 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RB | 28..971 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RA | 2..925 | 2..925 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42En-RB | 28..971 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7052774..7052995 | 1..222 | 99 | -> | Plus |
2R | 7053063..7053236 | 223..396 | 100 | -> | Plus |
2R | 7053301..7053456 | 397..552 | 100 | -> | Plus |
2R | 7053527..7053721 | 553..747 | 100 | -> | Plus |
2R | 7053848..7054044 | 748..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7052774..7052995 | 1..222 | 99 | -> | Plus |
2R | 7053063..7053236 | 223..396 | 100 | -> | Plus |
2R | 7053301..7053456 | 397..552 | 100 | -> | Plus |
2R | 7053527..7053721 | 553..747 | 100 | -> | Plus |
2R | 7053848..7054044 | 748..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7052774..7052995 | 1..222 | 99 | -> | Plus |
2R | 7053063..7053236 | 223..396 | 100 | -> | Plus |
2R | 7053301..7053456 | 397..552 | 100 | -> | Plus |
2R | 7053527..7053721 | 553..747 | 100 | -> | Plus |
2R | 7053848..7054044 | 748..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 2940279..2940500 | 1..222 | 99 | -> | Plus |
arm_2R | 2940568..2940741 | 223..396 | 100 | -> | Plus |
arm_2R | 2940806..2940961 | 397..552 | 100 | -> | Plus |
arm_2R | 2941032..2941226 | 553..747 | 100 | -> | Plus |
arm_2R | 2941353..2941549 | 748..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7053973..7054194 | 1..222 | 99 | -> | Plus |
2R | 7054262..7054435 | 223..396 | 100 | -> | Plus |
2R | 7054500..7054655 | 397..552 | 100 | -> | Plus |
2R | 7054726..7054920 | 553..747 | 100 | -> | Plus |
2R | 7055047..7055243 | 748..945 | 99 | Plus |
Translation from 162 to 818
> RH02160.hyp MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQ IFVGTFVVLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHST DYVERSKKDFLATWADQRTNVERISLLEQKYSCCGQLGAHDYILMGRGIP LSCYKDQERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAALG AATHLGITVRNKLRRERF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42En-PB | 218 | CG12839-PB | 1..218 | 1..218 | 1106 | 100 | Plus |
Tsp42En-PA | 218 | CG12839-PA | 1..218 | 1..218 | 1106 | 100 | Plus |
lbm-PB | 208 | CG2374-PB | 1..208 | 1..218 | 243 | 31.7 | Plus |
lbm-PA | 208 | CG2374-PA | 1..208 | 1..218 | 243 | 31.7 | Plus |
Tsp42Er-PA | 211 | CG12837-PA | 8..211 | 8..218 | 227 | 25.7 | Plus |
Translation from 162 to 818
> RH02160.pep MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQ IFVGTFVVLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHST DYVERSKKDFLATWADQRTNVERISLLEQKYSCCGQLGAHDYILMGRGIP LSCYKDQERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAALG AATHLGITVRNKLRRERF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12691-PA | 218 | GF12691-PA | 1..218 | 1..218 | 938 | 87.2 | Plus |
Dana\GF12690-PA | 208 | GF12690-PA | 1..208 | 1..218 | 222 | 29.1 | Plus |
Dana\GF12685-PA | 229 | GF12685-PA | 1..227 | 1..218 | 210 | 29.1 | Plus |
Dana\GF12251-PA | 219 | GF12251-PA | 1..218 | 1..218 | 199 | 26.9 | Plus |
Dana\GF12682-PA | 227 | GF12682-PA | 1..227 | 1..218 | 198 | 29.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23253-PA | 218 | GG23253-PA | 1..218 | 1..218 | 967 | 91.7 | Plus |
Dere\GG23252-PA | 208 | GG23252-PA | 1..208 | 1..218 | 225 | 31.5 | Plus |
Dere\GG23255-PA | 211 | GG23255-PA | 14..211 | 14..218 | 212 | 26.3 | Plus |
Dere\GG10774-PA | 219 | GG10774-PA | 1..218 | 1..218 | 201 | 28.3 | Plus |
Dere\GG23246-PA | 231 | GG23246-PA | 1..229 | 1..218 | 186 | 28.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21509-PA | 218 | GH21509-PA | 1..218 | 1..218 | 806 | 70.6 | Plus |
Dgri\GH10364-PA | 132 | GH10364-PA | 1..132 | 1..132 | 475 | 70.5 | Plus |
Dgri\GH21508-PA | 211 | GH21508-PA | 1..211 | 1..218 | 242 | 29.7 | Plus |
Dgri\GH21502-PA | 229 | GH21502-PA | 1..227 | 1..218 | 228 | 31.7 | Plus |
Dgri\GH21512-PA | 218 | GH21512-PA | 1..218 | 1..218 | 225 | 27 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42En-PB | 218 | CG12839-PB | 1..218 | 1..218 | 1106 | 100 | Plus |
Tsp42En-PA | 218 | CG12839-PA | 1..218 | 1..218 | 1106 | 100 | Plus |
lbm-PB | 208 | CG2374-PB | 1..208 | 1..218 | 243 | 31.7 | Plus |
lbm-PA | 208 | CG2374-PA | 1..208 | 1..218 | 243 | 31.7 | Plus |
Tsp42Er-PA | 211 | CG12837-PA | 8..211 | 8..218 | 227 | 25.7 | Plus |
Tsp42Eq-PA | 219 | CG12832-PA | 1..218 | 1..218 | 225 | 29.2 | Plus |
Tsp42Eg-PA | 218 | CG12142-PA | 1..215 | 1..218 | 199 | 29.5 | Plus |
Tsp42Eh-PB | 231 | CG12844-PB | 1..229 | 1..218 | 199 | 27.5 | Plus |
Tsp42Ee-PB | 228 | CG10106-PB | 1..228 | 1..218 | 195 | 28.2 | Plus |
Tsp42Ee-PA | 228 | CG10106-PA | 1..228 | 1..218 | 195 | 28.2 | Plus |
Tsp42Ei-PB | 229 | CG12843-PB | 8..223 | 8..215 | 192 | 26.4 | Plus |
Tsp42Ei-PA | 229 | CG12843-PA | 8..223 | 8..215 | 192 | 26.4 | Plus |
Tsp42El-PA | 217 | CG12840-PA | 1..217 | 1..218 | 183 | 26.1 | Plus |
Tsp42Ed-PB | 227 | CG12846-PB | 1..227 | 1..218 | 182 | 28.6 | Plus |
Tsp42Ed-PA | 227 | CG12846-PA | 1..227 | 1..218 | 182 | 28.6 | Plus |
Tsp42Eo-PA | 219 | CG12838-PA | 13..175 | 13..174 | 176 | 26.2 | Plus |
Tsp42Ea-PC | 226 | CG18817-PC | 1..226 | 1..218 | 168 | 23.5 | Plus |
Tsp42Ea-PB | 226 | CG18817-PB | 1..226 | 1..218 | 168 | 23.5 | Plus |
Tsp42Ea-PA | 226 | CG18817-PA | 1..226 | 1..218 | 168 | 23.5 | Plus |
Tsp42Ek-PB | 215 | CG12841-PB | 1..204 | 1..200 | 167 | 24.9 | Plus |
Tsp42Ek-PA | 215 | CG12841-PA | 1..204 | 1..200 | 167 | 24.9 | Plus |
CG30160-PA | 222 | CG30160-PA | 1..207 | 1..200 | 143 | 27.9 | Plus |
Tsp42Eb-PB | 222 | CG18816-PB | 1..207 | 1..200 | 143 | 27.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19479-PA | 218 | GI19479-PA | 23..218 | 23..218 | 746 | 69.4 | Plus |
Dmoj\GI19481-PA | 220 | GI19481-PA | 1..220 | 1..218 | 238 | 27 | Plus |
Dmoj\GI19472-PA | 227 | GI19472-PA | 1..225 | 1..218 | 233 | 29.8 | Plus |
Dmoj\GI19477-PA | 208 | GI19477-PA | 1..208 | 1..218 | 223 | 30 | Plus |
Dmoj\GI20057-PA | 219 | GI20057-PA | 1..218 | 1..218 | 187 | 27.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11148-PA | 218 | GL11148-PA | 1..218 | 1..218 | 901 | 83.5 | Plus |
Dper\GL11147-PA | 208 | GL11147-PA | 1..208 | 1..218 | 219 | 29.7 | Plus |
Dper\GL11150-PA | 210 | GL11150-PA | 3..206 | 11..217 | 186 | 24.2 | Plus |
Dper\GL11146-PA | 217 | GL11146-PA | 1..217 | 1..218 | 168 | 25.3 | Plus |
Dper\GL11149-PA | 219 | GL11149-PA | 8..175 | 8..174 | 168 | 23.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11845-PA | 218 | GA11845-PA | 1..218 | 1..218 | 901 | 83.5 | Plus |
Dpse\GA24625-PA | 208 | GA24625-PA | 1..208 | 1..218 | 219 | 29.7 | Plus |
Dpse\GA10076-PA | 228 | GA10076-PA | 1..228 | 1..218 | 193 | 28.2 | Plus |
Dpse\GA11839-PA | 219 | GA11839-PA | 1..218 | 1..218 | 189 | 27.9 | Plus |
Dpse\GA11849-PA | 231 | GA11849-PA | 1..229 | 1..218 | 187 | 27.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20926-PA | 218 | GM20926-PA | 1..218 | 1..218 | 1096 | 96.8 | Plus |
Dsec\GM20925-PA | 208 | GM20925-PA | 1..208 | 1..218 | 239 | 31.1 | Plus |
Dsec\GM20823-PA | 219 | GM20823-PA | 1..218 | 1..218 | 202 | 28.3 | Plus |
Dsec\GM20918-PA | 231 | GM20918-PA | 1..229 | 1..218 | 200 | 28.8 | Plus |
Dsec\GM20919-PA | 229 | GM20919-PA | 1..225 | 1..217 | 175 | 27.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10455-PA | 211 | GD10455-PA | 14..211 | 14..218 | 228 | 26.4 | Plus |
Dsim\GD15337-PA | 188 | GD15337-PA | 12..188 | 32..218 | 209 | 31.4 | Plus |
Dsim\GD10276-PA | 219 | GD10276-PA | 1..218 | 1..218 | 199 | 28.3 | Plus |
Dsim\GD10448-PA | 229 | GD10448-PA | 1..225 | 1..217 | 174 | 27.6 | Plus |
Dsim\GD10280-PA | 227 | GD10280-PA | 1..227 | 1..218 | 170 | 28.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15139-PA | 218 | GJ15139-PA | 1..218 | 1..218 | 864 | 75.2 | Plus |
Dvir\GJ15138-PA | 208 | GJ15138-PA | 1..208 | 1..218 | 253 | 32.4 | Plus |
Dvir\GJ15133-PA | 229 | GJ15133-PA | 1..227 | 1..218 | 206 | 30.4 | Plus |
Dvir\GJ14948-PA | 219 | GJ14948-PA | 1..218 | 1..218 | 205 | 29.7 | Plus |
Dvir\GJ15141-PA | 220 | GJ15141-PA | 1..220 | 1..218 | 201 | 27.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21785-PA | 218 | GK21785-PA | 1..218 | 1..218 | 798 | 77.5 | Plus |
Dwil\GK21784-PA | 208 | GK21784-PA | 1..208 | 1..218 | 240 | 28 | Plus |
Dwil\GK21787-PA | 215 | GK21787-PA | 1..215 | 1..218 | 219 | 26 | Plus |
Dwil\GK21531-PA | 219 | GK21531-PA | 1..218 | 1..218 | 209 | 28.8 | Plus |
Dwil\GK21779-PA | 231 | GK21779-PA | 9..229 | 8..218 | 194 | 29 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19103-PA | 218 | GE19103-PA | 1..218 | 1..218 | 970 | 92.7 | Plus |
Dyak\GE19105-PA | 211 | GE19105-PA | 14..211 | 14..218 | 229 | 26.4 | Plus |
Dyak\GE19102-PA | 208 | GE19102-PA | 1..208 | 1..218 | 228 | 29.7 | Plus |
Dyak\GE24235-PA | 219 | GE24235-PA | 1..218 | 1..218 | 204 | 28.8 | Plus |
Dyak\GE19098-PA | 229 | GE19098-PA | 1..225 | 1..217 | 171 | 26.1 | Plus |