Clone RH02160 Report

Search the DGRC for RH02160

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:21
Well:60
Vector:pFlc-1
Associated Gene/TranscriptTsp42En-RA
Protein status:RH02160.pep: gold
Preliminary Size:657
Sequenced Size:959

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12839 2002-01-01 Sim4 clustering to Release 2
CG12839 2002-12-11 Blastp of sequenced clone
CG12839 2003-01-01 Sim4 clustering to Release 3
Tsp42En 2008-04-29 Release 5.5 accounting
Tsp42En 2008-08-15 Release 5.9 accounting
Tsp42En 2008-12-18 5.12 accounting

Clone Sequence Records

RH02160.complete Sequence

959 bp (959 high quality bases) assembled on 2002-12-11

GenBank Submission: AY071666

> RH02160.complete
GAGTCGCACGTCAACCTCTATGCCAATAGGGCTGGCGGATTTCATTGGGT
CTTCGCTTCTCCGGTGGTCGACGCTTCGGGTCAAGTGCGCAGCGGAAAAT
TGGTGCGGGAACAAGGATAAACGCACCTTCGTGGTTAATTATAGGGATTA
TTGATTGGCAACATGGACTGCCGCACATCGTTCCTGAAAGCCGTTCTTAT
CGTTCTCAATGTGCTGCTATCGCTGATTGGAGTGACGTTGATTGCTCTGT
CCGTGTACGAGCTGAACAGCTCCACGCCGGGCACCTTCGAGCACATCGCC
ATCGTTGTCCAGATCTTCGTGGGCACCTTCGTGGTCCTGACCTCGTTTCT
GGGCTGCTTTGCCACCGCTCGGGTTTCCCTGGGACTGGTTTGGAGCTATG
TGATCTGCCTGCTGATCCTGCTGTGCCTGCAGATTTATATTATCGCGGCA
GCCCACTCCACGGACTACGTGGAGCGATCCAAGAAGGATTTCCTGGCCAC
CTGGGCTGATCAAAGGACCAATGTGGAGCGCATATCGCTCCTTGAGCAAA
AGTACTCCTGCTGCGGCCAGTTGGGCGCCCATGACTACATCCTGATGGGA
CGGGGTATACCCTTGAGCTGCTACAAGGATCAGGAGCGGCGCGAGTACAG
CCTCTTCTCCGGGGGCTGCCTGCAGGCCGTGCAGGCGCATGCCACGGACA
ACGTGGCCATCGGACTCATCATCAAGTGGCTGCTGCTTCTGGTGGAGTTC
GCCGCCCTGGGAGCCGCAACCCACTTGGGCATCACGGTGCGCAATAAATT
GCGGCGCGAAAGATTCTAACAGGTCGCTTGGAATCATCGAAATCGGGTGT
TGGCAACGCATAATCCGATATCTATGGATTTTTATAGCAGTTTAAGATGA
TCTGGAGGCAACAGAAGCGTAGAATAAAAAATAAACCAAAATCACAAAAA
AAAAAAAAA

RH02160.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42En-RA 1432 Tsp42En-RA 135..1077 2..944 4715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2940180..2940400 2..222 1090 99.5 Plus
chr2R 21145070 chr2R 2941251..2941449 746..944 995 100 Plus
chr2R 21145070 chr2R 2940930..2941126 551..747 985 100 Plus
chr2R 21145070 chr2R 2940467..2940641 222..396 875 100 Plus
chr2R 21145070 chr2R 2940706..2940861 397..552 780 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7052775..7052995 2..222 1105 100 Plus
2R 25286936 2R 7053846..7054044 746..944 995 100 Plus
2R 25286936 2R 7053525..7053721 551..747 985 100 Plus
2R 25286936 2R 7053062..7053236 222..396 875 100 Plus
2R 25286936 2R 7053301..7053456 397..552 780 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7053974..7054194 2..222 1105 100 Plus
2R 25260384 2R 7055045..7055243 746..944 995 100 Plus
2R 25260384 2R 7054724..7054920 551..747 985 100 Plus
2R 25260384 2R 7054261..7054435 222..396 875 100 Plus
2R 25260384 2R 7054500..7054655 397..552 780 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:17:14 has no hits.

RH02160.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:18:02 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2941253..2941449 748..945 99   Plus
chr2R 2940468..2940641 223..396 100 -> Plus
chr2R 2940706..2940861 397..552 100 -> Plus
chr2R 2940932..2941126 553..747 100 -> Plus
chr2R 2940179..2940400 1..222 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:14 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 1..657 163..819 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:01:04 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 1..657 163..819 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:07:48 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 1..657 163..819 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:51:31 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 1..657 163..819 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:27 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 1..657 163..819 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:18:33 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 2..925 2..925 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:01:04 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 2..925 2..925 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:07:48 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RB 28..971 1..945 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:51:31 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RA 2..925 2..925 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:27 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42En-RB 28..971 1..945 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:02 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7052774..7052995 1..222 99 -> Plus
2R 7053063..7053236 223..396 100 -> Plus
2R 7053301..7053456 397..552 100 -> Plus
2R 7053527..7053721 553..747 100 -> Plus
2R 7053848..7054044 748..945 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:02 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7052774..7052995 1..222 99 -> Plus
2R 7053063..7053236 223..396 100 -> Plus
2R 7053301..7053456 397..552 100 -> Plus
2R 7053527..7053721 553..747 100 -> Plus
2R 7053848..7054044 748..945 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:02 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7052774..7052995 1..222 99 -> Plus
2R 7053063..7053236 223..396 100 -> Plus
2R 7053301..7053456 397..552 100 -> Plus
2R 7053527..7053721 553..747 100 -> Plus
2R 7053848..7054044 748..945 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:07:48 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2940279..2940500 1..222 99 -> Plus
arm_2R 2940568..2940741 223..396 100 -> Plus
arm_2R 2940806..2940961 397..552 100 -> Plus
arm_2R 2941032..2941226 553..747 100 -> Plus
arm_2R 2941353..2941549 748..945 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:23:24 Download gff for RH02160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7053973..7054194 1..222 99 -> Plus
2R 7054262..7054435 223..396 100 -> Plus
2R 7054500..7054655 397..552 100 -> Plus
2R 7054726..7054920 553..747 100 -> Plus
2R 7055047..7055243 748..945 99   Plus

RH02160.hyp Sequence

Translation from 162 to 818

> RH02160.hyp
MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQ
IFVGTFVVLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHST
DYVERSKKDFLATWADQRTNVERISLLEQKYSCCGQLGAHDYILMGRGIP
LSCYKDQERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAALG
AATHLGITVRNKLRRERF*

RH02160.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42En-PB 218 CG12839-PB 1..218 1..218 1106 100 Plus
Tsp42En-PA 218 CG12839-PA 1..218 1..218 1106 100 Plus
lbm-PB 208 CG2374-PB 1..208 1..218 243 31.7 Plus
lbm-PA 208 CG2374-PA 1..208 1..218 243 31.7 Plus
Tsp42Er-PA 211 CG12837-PA 8..211 8..218 227 25.7 Plus

RH02160.pep Sequence

Translation from 162 to 818

> RH02160.pep
MDCRTSFLKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQ
IFVGTFVVLTSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHST
DYVERSKKDFLATWADQRTNVERISLLEQKYSCCGQLGAHDYILMGRGIP
LSCYKDQERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAALG
AATHLGITVRNKLRRERF*

RH02160.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12691-PA 218 GF12691-PA 1..218 1..218 938 87.2 Plus
Dana\GF12690-PA 208 GF12690-PA 1..208 1..218 222 29.1 Plus
Dana\GF12685-PA 229 GF12685-PA 1..227 1..218 210 29.1 Plus
Dana\GF12251-PA 219 GF12251-PA 1..218 1..218 199 26.9 Plus
Dana\GF12682-PA 227 GF12682-PA 1..227 1..218 198 29.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23253-PA 218 GG23253-PA 1..218 1..218 967 91.7 Plus
Dere\GG23252-PA 208 GG23252-PA 1..208 1..218 225 31.5 Plus
Dere\GG23255-PA 211 GG23255-PA 14..211 14..218 212 26.3 Plus
Dere\GG10774-PA 219 GG10774-PA 1..218 1..218 201 28.3 Plus
Dere\GG23246-PA 231 GG23246-PA 1..229 1..218 186 28.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21509-PA 218 GH21509-PA 1..218 1..218 806 70.6 Plus
Dgri\GH10364-PA 132 GH10364-PA 1..132 1..132 475 70.5 Plus
Dgri\GH21508-PA 211 GH21508-PA 1..211 1..218 242 29.7 Plus
Dgri\GH21502-PA 229 GH21502-PA 1..227 1..218 228 31.7 Plus
Dgri\GH21512-PA 218 GH21512-PA 1..218 1..218 225 27 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42En-PB 218 CG12839-PB 1..218 1..218 1106 100 Plus
Tsp42En-PA 218 CG12839-PA 1..218 1..218 1106 100 Plus
lbm-PB 208 CG2374-PB 1..208 1..218 243 31.7 Plus
lbm-PA 208 CG2374-PA 1..208 1..218 243 31.7 Plus
Tsp42Er-PA 211 CG12837-PA 8..211 8..218 227 25.7 Plus
Tsp42Eq-PA 219 CG12832-PA 1..218 1..218 225 29.2 Plus
Tsp42Eg-PA 218 CG12142-PA 1..215 1..218 199 29.5 Plus
Tsp42Eh-PB 231 CG12844-PB 1..229 1..218 199 27.5 Plus
Tsp42Ee-PB 228 CG10106-PB 1..228 1..218 195 28.2 Plus
Tsp42Ee-PA 228 CG10106-PA 1..228 1..218 195 28.2 Plus
Tsp42Ei-PB 229 CG12843-PB 8..223 8..215 192 26.4 Plus
Tsp42Ei-PA 229 CG12843-PA 8..223 8..215 192 26.4 Plus
Tsp42El-PA 217 CG12840-PA 1..217 1..218 183 26.1 Plus
Tsp42Ed-PB 227 CG12846-PB 1..227 1..218 182 28.6 Plus
Tsp42Ed-PA 227 CG12846-PA 1..227 1..218 182 28.6 Plus
Tsp42Eo-PA 219 CG12838-PA 13..175 13..174 176 26.2 Plus
Tsp42Ea-PC 226 CG18817-PC 1..226 1..218 168 23.5 Plus
Tsp42Ea-PB 226 CG18817-PB 1..226 1..218 168 23.5 Plus
Tsp42Ea-PA 226 CG18817-PA 1..226 1..218 168 23.5 Plus
Tsp42Ek-PB 215 CG12841-PB 1..204 1..200 167 24.9 Plus
Tsp42Ek-PA 215 CG12841-PA 1..204 1..200 167 24.9 Plus
CG30160-PA 222 CG30160-PA 1..207 1..200 143 27.9 Plus
Tsp42Eb-PB 222 CG18816-PB 1..207 1..200 143 27.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19479-PA 218 GI19479-PA 23..218 23..218 746 69.4 Plus
Dmoj\GI19481-PA 220 GI19481-PA 1..220 1..218 238 27 Plus
Dmoj\GI19472-PA 227 GI19472-PA 1..225 1..218 233 29.8 Plus
Dmoj\GI19477-PA 208 GI19477-PA 1..208 1..218 223 30 Plus
Dmoj\GI20057-PA 219 GI20057-PA 1..218 1..218 187 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11148-PA 218 GL11148-PA 1..218 1..218 901 83.5 Plus
Dper\GL11147-PA 208 GL11147-PA 1..208 1..218 219 29.7 Plus
Dper\GL11150-PA 210 GL11150-PA 3..206 11..217 186 24.2 Plus
Dper\GL11146-PA 217 GL11146-PA 1..217 1..218 168 25.3 Plus
Dper\GL11149-PA 219 GL11149-PA 8..175 8..174 168 23.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11845-PA 218 GA11845-PA 1..218 1..218 901 83.5 Plus
Dpse\GA24625-PA 208 GA24625-PA 1..208 1..218 219 29.7 Plus
Dpse\GA10076-PA 228 GA10076-PA 1..228 1..218 193 28.2 Plus
Dpse\GA11839-PA 219 GA11839-PA 1..218 1..218 189 27.9 Plus
Dpse\GA11849-PA 231 GA11849-PA 1..229 1..218 187 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20926-PA 218 GM20926-PA 1..218 1..218 1096 96.8 Plus
Dsec\GM20925-PA 208 GM20925-PA 1..208 1..218 239 31.1 Plus
Dsec\GM20823-PA 219 GM20823-PA 1..218 1..218 202 28.3 Plus
Dsec\GM20918-PA 231 GM20918-PA 1..229 1..218 200 28.8 Plus
Dsec\GM20919-PA 229 GM20919-PA 1..225 1..217 175 27.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10455-PA 211 GD10455-PA 14..211 14..218 228 26.4 Plus
Dsim\GD15337-PA 188 GD15337-PA 12..188 32..218 209 31.4 Plus
Dsim\GD10276-PA 219 GD10276-PA 1..218 1..218 199 28.3 Plus
Dsim\GD10448-PA 229 GD10448-PA 1..225 1..217 174 27.6 Plus
Dsim\GD10280-PA 227 GD10280-PA 1..227 1..218 170 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15139-PA 218 GJ15139-PA 1..218 1..218 864 75.2 Plus
Dvir\GJ15138-PA 208 GJ15138-PA 1..208 1..218 253 32.4 Plus
Dvir\GJ15133-PA 229 GJ15133-PA 1..227 1..218 206 30.4 Plus
Dvir\GJ14948-PA 219 GJ14948-PA 1..218 1..218 205 29.7 Plus
Dvir\GJ15141-PA 220 GJ15141-PA 1..220 1..218 201 27.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21785-PA 218 GK21785-PA 1..218 1..218 798 77.5 Plus
Dwil\GK21784-PA 208 GK21784-PA 1..208 1..218 240 28 Plus
Dwil\GK21787-PA 215 GK21787-PA 1..215 1..218 219 26 Plus
Dwil\GK21531-PA 219 GK21531-PA 1..218 1..218 209 28.8 Plus
Dwil\GK21779-PA 231 GK21779-PA 9..229 8..218 194 29 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19103-PA 218 GE19103-PA 1..218 1..218 970 92.7 Plus
Dyak\GE19105-PA 211 GE19105-PA 14..211 14..218 229 26.4 Plus
Dyak\GE19102-PA 208 GE19102-PA 1..208 1..218 228 29.7 Plus
Dyak\GE24235-PA 219 GE24235-PA 1..218 1..218 204 28.8 Plus
Dyak\GE19098-PA 229 GE19098-PA 1..225 1..217 171 26.1 Plus