Clone RH02253 Report

Search the DGRC for RH02253

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:22
Well:53
Vector:pFlc-1
Associated Gene/TranscriptDpt-RA
Protein status:RH02253.pep: gold
Preliminary Size:483
Sequenced Size:511

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12763 2001-12-17 Blastp of sequenced clone
CG12763 2002-01-01 Sim4 clustering to Release 2
CG12763 2003-01-01 Sim4 clustering to Release 3
Dpt 2008-04-29 Release 5.5 accounting
Dpt 2008-08-15 Release 5.9 accounting
Dpt 2008-12-18 5.12 accounting

Clone Sequence Records

RH02253.complete Sequence

511 bp (511 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071667

> RH02253.complete
GATCAGTCAGCATATTCCAGTTCTTCAATTGAGAACAACTGAGATGCAGT
TCACCATTGCCGTCGCCTTACTTTGCTGCGCAATCGCTTCTACTTTGGCT
TATCCGATGCCCGACGACATGACCATGAAGCCCACTCCACCACCGCAGTA
CCCACTCAATCTTCAGGGAGGCGGCGGTGGCCAGAGCGGCGATGGTTTTG
GCTTTGCAGTCCAGGGTCACCAGAAGGTGTGGACCAGCGACAATGGACGC
CACGAGATTGGACTGAATGGAGGATATGGACAGCACTTGGGAGGACCATA
TGGCAACTCAGAACCGAGCTGGAAAGTGGGAAGCACCTACACCTACAGAT
TTCCGAATTTCTAAGCTTCATAAATATTTTATTGTAAAAAACTTCACCAA
ATATTATCTCGATTGGTATCCGAGTCTAGCTATTATAAAAACCATACCCA
CTTTGTATATTCAGATAATTGCAAAATATATAACCGAATACAACGAAAAA
AAAAAAAAAAA

RH02253.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpt-RA 496 Dpt-RA 3..496 2..495 2470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14752904..14753397 2..495 2470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18865767..18866261 2..496 2475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18866966..18867460 2..496 2475 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:31:41 has no hits.

RH02253.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:32:26 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14752902..14753397 1..495 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:17 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..321 44..364 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:24 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..321 44..364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:33:04 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..321 44..364 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:02 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..321 44..364 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:01:28 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..321 44..364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:21 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..496 1..495 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:24 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..496 1..495 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:33:04 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..496 1..495 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:03 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..496 1..495 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:01:28 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
Dpt-RA 1..496 1..495 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:32:26 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18865765..18866260 1..495 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:32:26 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18865765..18866260 1..495 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:32:26 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18865765..18866260 1..495 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:33:04 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14753270..14753765 1..495 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:28 Download gff for RH02253.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18866964..18867459 1..495 99   Plus

RH02253.hyp Sequence

Translation from 0 to 363

> RH02253.hyp
ISQHIPVLQLRTTEMQFTIAVALLCCAIASTLAYPMPDDMTMKPTPPPQY
PLNLQGGGGGQSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPY
GNSEPSWKVGSTYTYRFPNF*

RH02253.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpt-PA 106 CG12763-PA 1..106 15..120 597 100 Plus
DptB-PA 120 CG10794-PA 1..120 15..117 240 41.7 Plus

RH02253.pep Sequence

Translation from 43 to 363

> RH02253.pep
MQFTIAVALLCCAIASTLAYPMPDDMTMKPTPPPQYPLNLQGGGGGQSGD
GFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYT
YRFPNF*

RH02253.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11124-PA 99 GF11124-PA 1..99 1..103 298 66 Plus
Dana\GF11125-PA 123 GF11125-PA 8..123 5..103 169 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21934-PA 106 GG21934-PA 1..106 1..106 347 84 Plus
Dere\GG21935-PA 120 GG21935-PA 1..120 1..103 200 44.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22133-PA 109 GH22133-PA 1..109 1..103 220 45.5 Plus
Dgri\GH22131-PA 109 GH22131-PA 1..109 1..103 220 45.5 Plus
Dgri\GH22132-PA 117 GH22132-PA 54..117 38..103 179 54.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
DptA-PA 106 CG12763-PA 1..106 1..106 597 100 Plus
DptB-PA 120 CG10794-PA 1..120 1..103 240 41.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19361-PA 111 GI19361-PA 6..111 7..103 195 41.5 Plus
Dmoj\GI19360-PA 114 GI19360-PA 1..114 1..103 193 39.1 Plus
Dmoj\GI19362-PA 141 GI19362-PA 78..141 38..103 179 53 Plus
Dmoj\GI20150-PA 111 GI20150-PA 15..111 16..103 156 40.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11494-PA 102 GL11494-PA 1..102 1..103 349 62.1 Plus
Dper\GL11493-PA 102 GL11493-PA 1..102 1..103 343 61.2 Plus
Dper\GL11495-PA 125 GL11495-PA 73..125 51..103 159 56.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24749-PA 102 GA24749-PA 1..102 1..103 348 62.1 Plus
Dpse\GA11797-PA 102 GA11797-PA 1..102 1..103 347 62.1 Plus
Dpse\GA10563-PA 125 GA10563-PA 73..125 51..103 160 56.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21923-PA 105 GM21923-PA 1..105 1..105 443 93.3 Plus
Dsec\GM21924-PA 120 GM21924-PA 1..120 1..103 187 41.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11417-PA 84 GD11417-PA 1..84 22..105 344 95.2 Plus
Dsim\GD11418-PA 124 GD11418-PA 1..124 1..105 284 62.1 Plus
Dsim\GD11419-PA 120 GD11419-PA 1..120 1..103 189 41.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19916-PA 111 GJ19916-PA 1..111 1..103 212 44.6 Plus
Dvir\GJ19915-PA 111 GJ19915-PA 1..111 1..103 212 44.6 Plus
Dvir\GJ19917-PA 142 GJ19917-PA 79..142 38..103 184 54.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20931-PA 103 GK20931-PA 1..103 1..106 221 56.5 Plus
Dwil\GK20932-PA 117 GK20932-PA 1..117 1..103 197 42.7 Plus
Dwil\GK20689-PA 112 GK20689-PA 1..111 1..97 143 36 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Dpt-PA 106 GE12007-PA 1..106 1..106 449 87.7 Plus
Dyak\DptB-PA 120 GE12008-PA 1..120 1..103 198 44.2 Plus