BDGP Sequence Production Resources |
Search the DGRC for RH02271
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 22 |
Well: | 71 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG17325-RA |
Protein status: | RH02271.pep: gold |
Sequenced Size: | 669 |
Gene | Date | Evidence |
---|---|---|
CG17325 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17325 | 2002-01-09 | Blastp of sequenced clone |
CG17325 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17325 | 2008-04-29 | Release 5.5 accounting |
CG42305 | 2008-08-15 | Release 5.9 accounting |
CG17325 | 2008-08-15 | Release 5.9 accounting |
CG42305 | 2008-12-18 | 5.12 accounting |
CG17325 | 2008-12-18 | 5.12 accounting |
669 bp (669 high quality bases) assembled on 2002-01-09
GenBank Submission: AY075530
> RH02271.complete GACACTAAAGTTCGAAGGCCTAGCAGTCGATACCTAATCAGTGATTTTCA AAAATATTTTCCCCAAAGTGCATAAACAAATGTGTCAATGAAGACACCGG ACACCAAAGCCAAGTTGCTGAATAATATAAGTCTATCTAAACACCTGTCT TCCAAGAAAGGCGGCTCTCGCACTAGTAACTGCGGCAATTGTCTGGAATT CTCCGTACTCACGCGTCTCTCCAGCGTGCCCTGAATCCCCCTGTGGTCCA AGCTCACCCAAGCTCCTGTTGAAACTTGAAAGAAATCATTGACAATGGTT CACCAAACTCGCACACCCAGCAAGGCCATTCCCGCCAAGCACCTGAGTCC CATGCGGACCGTGGAGGGTCTGGGCGGAAAGTACGCCGTTTCGAGCAGTC CGGCGGATAGTTTCCTGCGGAACACCAGGCTCACGGCTCAGAGCAGCTCC CAGCAGTCGGCCGCCTTCAAATACAATCAGATGGTCACCCACAATCGGGA GCAGTTCAATAACCTGCACTTCTGCTAGGAGACGGATAGGGATGTGGATG CACGTCGTCGCTGGAGAGACCGCATTGGAGGAGGGATATACCACTACTCG TACGATGACGATTGCTTGTCACCATACTTAAATGCAATAAATTCAATTTG AACAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 18811778..18811908 | 1..131 | 98 | -> | Plus |
chr2L | 18812063..18812584 | 132..653 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17325-RB | 1..234 | 295..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17325-RB | 1..234 | 295..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17325-RA | 1..234 | 295..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17325-RB | 1..234 | 295..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17325-RA | 1..234 | 295..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42305-RB | 4..656 | 1..653 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42305-RB | 4..656 | 1..653 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42305-RB | 5..657 | 1..653 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42305-RB | 4..656 | 1..653 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42305-RA | 5..657 | 1..653 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18813013..18813143 | 1..131 | 99 | -> | Plus |
2L | 18813298..18813819 | 132..653 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18813013..18813143 | 1..131 | 99 | -> | Plus |
2L | 18813298..18813819 | 132..653 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18813013..18813143 | 1..131 | 99 | -> | Plus |
2L | 18813298..18813819 | 132..653 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 18813013..18813143 | 1..131 | 99 | -> | Plus |
arm_2L | 18813298..18813819 | 132..653 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 18813298..18813819 | 132..653 | 100 | Plus | |
2L | 18813013..18813143 | 1..131 | 99 | -> | Plus |
Translation from 294 to 527
> RH02271.pep MVHQTRTPSKAIPAKHLSPMRTVEGLGGKYAVSSSPADSFLRNTRLTAQS SSQQSAAFKYNQMVTHNREQFNNLHFC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15418-PA | 78 | GF15418-PA | 1..78 | 1..77 | 357 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21133-PA | 77 | GG21133-PA | 1..77 | 1..77 | 343 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10544-PA | 81 | GH10544-PA | 1..81 | 1..77 | 277 | 67.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17325-PC | 77 | CG17325-PC | 1..77 | 1..77 | 399 | 100 | Plus |
CG17325-PB | 77 | CG17325-PB | 1..77 | 1..77 | 399 | 100 | Plus |
CG17325-PA | 77 | CG17325-PA | 1..77 | 1..77 | 399 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20932-PA | 89 | GI20932-PA | 1..89 | 1..77 | 259 | 60.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19441-PA | 88 | GL19441-PA | 1..88 | 1..77 | 278 | 67 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25962-PA | 88 | GA25962-PA | 1..88 | 1..77 | 278 | 67 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17293-PA | 77 | GM17293-PA | 1..77 | 1..77 | 402 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24156-PA | 77 | GD24156-PA | 1..77 | 1..77 | 409 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19898-PA | 84 | GJ19898-PA | 1..84 | 1..77 | 283 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14589-PA | 80 | GK14589-PA | 1..80 | 1..77 | 298 | 72.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13206-PA | 77 | GE13206-PA | 1..77 | 1..77 | 397 | 96.1 | Plus |
Translation from 294 to 527
> RH02271.hyp MVHQTRTPSKAIPAKHLSPMRTVEGLGGKYAVSSSPADSFLRNTRLTAQS SSQQSAAFKYNQMVTHNREQFNNLHFC*