Clone RH02271 Report

Search the DGRC for RH02271

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:22
Well:71
Vector:pFlc-1
Associated Gene/TranscriptCG17325-RA
Protein status:RH02271.pep: gold
Sequenced Size:669

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17325 2002-01-01 Sim4 clustering to Release 2
CG17325 2002-01-09 Blastp of sequenced clone
CG17325 2003-01-01 Sim4 clustering to Release 3
CG17325 2008-04-29 Release 5.5 accounting
CG42305 2008-08-15 Release 5.9 accounting
CG17325 2008-08-15 Release 5.9 accounting
CG42305 2008-12-18 5.12 accounting
CG17325 2008-12-18 5.12 accounting

Clone Sequence Records

RH02271.complete Sequence

669 bp (669 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075530

> RH02271.complete
GACACTAAAGTTCGAAGGCCTAGCAGTCGATACCTAATCAGTGATTTTCA
AAAATATTTTCCCCAAAGTGCATAAACAAATGTGTCAATGAAGACACCGG
ACACCAAAGCCAAGTTGCTGAATAATATAAGTCTATCTAAACACCTGTCT
TCCAAGAAAGGCGGCTCTCGCACTAGTAACTGCGGCAATTGTCTGGAATT
CTCCGTACTCACGCGTCTCTCCAGCGTGCCCTGAATCCCCCTGTGGTCCA
AGCTCACCCAAGCTCCTGTTGAAACTTGAAAGAAATCATTGACAATGGTT
CACCAAACTCGCACACCCAGCAAGGCCATTCCCGCCAAGCACCTGAGTCC
CATGCGGACCGTGGAGGGTCTGGGCGGAAAGTACGCCGTTTCGAGCAGTC
CGGCGGATAGTTTCCTGCGGAACACCAGGCTCACGGCTCAGAGCAGCTCC
CAGCAGTCGGCCGCCTTCAAATACAATCAGATGGTCACCCACAATCGGGA
GCAGTTCAATAACCTGCACTTCTGCTAGGAGACGGATAGGGATGTGGATG
CACGTCGTCGCTGGAGAGACCGCATTGGAGGAGGGATATACCACTACTCG
TACGATGACGATTGCTTGTCACCATACTTAAATGCAATAAATTCAATTTG
AACAAAAAAAAAAAAAAAA

RH02271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG17325-RA 778 CG17325-RA 5..659 2..656 3275 100 Plus
CG42305-RB 778 CG42305-RB 5..659 2..656 3275 100 Plus
CG42305-RA 656 CG42305-RA 5..656 2..653 3260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18812061..18812584 130..653 2575 99.4 Plus
chr2L 23010047 chr2L 18811779..18811908 2..131 635 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18813296..18813822 130..656 2635 100 Plus
2L 23513712 2L 18813014..18813143 2..131 650 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18813296..18813822 130..656 2635 100 Plus
2L 23513712 2L 18813014..18813143 2..131 650 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:37:29 has no hits.

RH02271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:23 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18811778..18811908 1..131 98 -> Plus
chr2L 18812063..18812584 132..653 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:18 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RB 1..234 295..528 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:51:03 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RB 1..234 295..528 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:20:19 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RA 1..234 295..528 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:26 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RB 1..234 295..528 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:37 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RA 1..234 295..528 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:14:46 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 4..656 1..653 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:51:03 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 4..656 1..653 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:20:19 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 5..657 1..653 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:26 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 4..656 1..653 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:37 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RA 5..657 1..653 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:23 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18813013..18813143 1..131 99 -> Plus
2L 18813298..18813819 132..653 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:23 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18813013..18813143 1..131 99 -> Plus
2L 18813298..18813819 132..653 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:23 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18813013..18813143 1..131 99 -> Plus
2L 18813298..18813819 132..653 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:20:19 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18813013..18813143 1..131 99 -> Plus
arm_2L 18813298..18813819 132..653 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:28 Download gff for RH02271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18813298..18813819 132..653 100   Plus
2L 18813013..18813143 1..131 99 -> Plus

RH02271.pep Sequence

Translation from 294 to 527

> RH02271.pep
MVHQTRTPSKAIPAKHLSPMRTVEGLGGKYAVSSSPADSFLRNTRLTAQS
SSQQSAAFKYNQMVTHNREQFNNLHFC*

RH02271.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15418-PA 78 GF15418-PA 1..78 1..77 357 88.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21133-PA 77 GG21133-PA 1..77 1..77 343 94.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10544-PA 81 GH10544-PA 1..81 1..77 277 67.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17325-PC 77 CG17325-PC 1..77 1..77 399 100 Plus
CG17325-PB 77 CG17325-PB 1..77 1..77 399 100 Plus
CG17325-PA 77 CG17325-PA 1..77 1..77 399 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20932-PA 89 GI20932-PA 1..89 1..77 259 60.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19441-PA 88 GL19441-PA 1..88 1..77 278 67 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25962-PA 88 GA25962-PA 1..88 1..77 278 67 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17293-PA 77 GM17293-PA 1..77 1..77 402 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24156-PA 77 GD24156-PA 1..77 1..77 409 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19898-PA 84 GJ19898-PA 1..84 1..77 283 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14589-PA 80 GK14589-PA 1..80 1..77 298 72.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13206-PA 77 GE13206-PA 1..77 1..77 397 96.1 Plus

RH02271.hyp Sequence

Translation from 294 to 527

> RH02271.hyp
MVHQTRTPSKAIPAKHLSPMRTVEGLGGKYAVSSSPADSFLRNTRLTAQS
SSQQSAAFKYNQMVTHNREQFNNLHFC*

RH02271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG17325-PC 77 CG17325-PC 1..77 1..77 399 100 Plus
CG17325-PB 77 CG17325-PB 1..77 1..77 399 100 Plus
CG17325-PA 77 CG17325-PA 1..77 1..77 399 100 Plus