Clone RH02303 Report

Search the DGRC for RH02303

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:23
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG9837-RE
Protein status:RH02303.pep: gold
Preliminary Size:631
Sequenced Size:819

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9837 2001-12-13 Blastp of sequenced clone
CG9837 2002-01-01 Sim4 clustering to Release 2
CG9837 2003-01-01 Sim4 clustering to Release 3
CG9837 2008-04-29 Release 5.5 accounting
CG9837 2008-08-15 Release 5.9 accounting
CG9837 2008-12-18 5.12 accounting

Clone Sequence Records

RH02303.complete Sequence

819 bp (819 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070638

> RH02303.complete
GAGTCAAACATTTCCCAGTTCACCGACAAGATGTGGTCCTCTAAGACTAT
TTTGGTTTTCCTAGCAGCATTTACTTTGGTCCAGGGTAGCATGCGGTTTC
ACTTCACCTTGGACTTTCACGTACAGCAGCCGCCGAATGCATCCGACACC
ATCGACAAGACCATTATTGTGGAGAACGATCGGATATCTATGGTGGACAA
CGAAGGAGCGACTACTAAGGCTCCGATGACCCAGTGGACAGATCAGGATC
AGTATAATCAGGACGCATTGCTGAAGGTGACCGATACGCGCAGATCGGTG
CAACAGCTGAATACGGAGCTCTCACCCCTGGTTGGCAGGAGCACCGATTT
GGCCAGAAGGATTAAGCAGAGTATGCGATACGTCAACGAGGTGGATGCTA
ATCTGGACGATTTGAGCAACTTTGGGCAGCTGGTGGAGCTGCTCAAGAAA
TTCGTAATCCTAGTCGATAACCTAAGGGATCCAAACAATCTCGGAGGCAT
TCGAAGCCTGGAGTACGTACTCCTGAAGTTGGCTCTAGAGAAGTACGACC
TTCTGAACAAGCGACAGGAGATCGGTGAATACTTGGAAAGGGCGGAGAGT
GCCTGGCGAAGATACCAAAACACACAGGTGGTTGTTCTGGATAACTCCAC
CTGAGTCGGGCTCAGATGCCTAGGACCACCACATTAGGAACTTAGTTTTA
GGATAAAACAGAACAAAGACCAGCATCATGGGTCGACACAATCGCTGCAC
CATGATCTACTAGAGCGGCTCGGCTCTTGAAAGGAATAAAAGACATCGAA
GGGAAAAAAAAAAAAAAAA

RH02303.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9837.a 1539 CG9837.a 388..1190 2..804 4015 100 Plus
CG9837-RC 1190 CG9837-RC 388..1190 2..804 4015 100 Plus
CG9837-RB 801 CG9837-RB 1..801 2..803 3940 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4634898..4635618 803..83 3605 100 Minus
chr3R 27901430 chr3R 4635677..4635760 85..2 420 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:17:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8808948..8809669 804..83 3610 100 Minus
3R 32079331 3R 8809728..8809811 85..2 420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8549779..8550500 804..83 3610 100 Minus
3R 31820162 3R 8550559..8550642 85..2 420 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:40:42 has no hits.

RH02303.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:41:23 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4634898..4635611 90..803 100 <- Minus
chr3R 4635674..4635760 1..89 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:20 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RA 1..624 31..654 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:29 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RC 55..708 1..654 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:07:31 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RE 1..624 31..654 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:35 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RA 1..624 31..654 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:58 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RE 1..624 31..654 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:48 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RA 1..802 2..803 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:28 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RC 55..857 1..803 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:31 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RE 1..802 2..803 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:37 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RA 1..802 2..803 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:58 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
CG9837-RE 1..802 2..803 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:41:23 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8808949..8809662 90..803 100 <- Minus
3R 8809725..8809811 1..89 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:41:23 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8808949..8809662 90..803 100 <- Minus
3R 8809725..8809811 1..89 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:41:23 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8808949..8809662 90..803 100 <- Minus
3R 8809725..8809811 1..89 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:31 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4634671..4635384 90..803 100 <- Minus
arm_3R 4635447..4635533 1..89 95   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:39 Download gff for RH02303.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8549780..8550493 90..803 100 <- Minus
3R 8550556..8550642 1..89 95   Minus

RH02303.pep Sequence

Translation from 30 to 653

> RH02303.pep
MWSSKTILVFLAAFTLVQGSMRFHFTLDFHVQQPPNASDTIDKTIIVEND
RISMVDNEGATTKAPMTQWTDQDQYNQDALLKVTDTRRSVQQLNTELSPL
VGRSTDLARRIKQSMRYVNEVDANLDDLSNFGQLVELLKKFVILVDNLRD
PNNLGGIRSLEYVLLKLALEKYDLLNKRQEIGEYLERAESAWRRYQNTQV
VVLDNST*

RH02303.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16828-PA 211 GF16828-PA 9..211 4..207 699 64.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17416-PA 235 GG17416-PA 29..235 1..207 994 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19332-PA 206 GH19332-PA 16..206 11..206 573 55.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9837-PF 207 CG9837-PF 1..207 1..207 1049 100 Plus
CG9837-PE 207 CG9837-PE 1..207 1..207 1049 100 Plus
CG9837-PD 187 CG9837-PD 1..187 21..207 951 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23942-PA 193 GI23942-PA 18..193 23..205 486 50.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12121-PA 206 GL12121-PA 2..203 4..206 719 67.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22066-PA 212 GA22066-PA 9..209 4..206 723 67.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26302-PA 207 GM26302-PA 1..207 1..207 1044 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20837-PA 207 GD20837-PA 1..207 1..207 1050 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23731-PA 204 GJ23731-PA 11..201 7..202 557 54.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11820-PA 212 GK11820-PA 14..212 11..205 551 56.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24816-PA 207 GE24816-PA 1..207 1..207 1002 92.3 Plus

RH02303.hyp Sequence

Translation from 90 to 653

> RH02303.hyp
MRFHFTLDFHVQQPPNASDTIDKTIIVENDRISMVDNEGATTKAPMTQWT
DQDQYNQDALLKVTDTRRSVQQLNTELSPLVGRSTDLARRIKQSMRYVNE
VDANLDDLSNFGQLVELLKKFVILVDNLRDPNNLGGIRSLEYVLLKLALE
KYDLLNKRQEIGEYLERAESAWRRYQNTQVVVLDNST*

RH02303.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG9837-PD 187 CG9837-PD 1..187 1..187 951 100 Plus
CG9837-PF 207 CG9837-PF 21..207 1..187 951 100 Plus
CG9837-PE 207 CG9837-PE 21..207 1..187 951 100 Plus