Clone RH02452 Report

Search the DGRC for RH02452

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:24
Well:52
Vector:pFlc-1
Associated Gene/TranscriptFMRFa-RA
Protein status:RH02452.pep: gold
Preliminary Size:1044
Sequenced Size:1443

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2346 2001-12-13 Blastp of sequenced clone
CG2346 2002-01-01 Sim4 clustering to Release 2
CG2346 2003-01-01 Sim4 clustering to Release 3
Fmrf 2008-04-29 Release 5.5 accounting
Fmrf 2008-08-15 Release 5.9 accounting
Fmrf 2008-12-18 5.12 accounting

Clone Sequence Records

RH02452.complete Sequence

1443 bp (1443 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070639

> RH02452.complete
GACAGAACTGTTCCACCTTCGAGCGGGCAACAAGTGTGTGTGCGGCCCAA
AAGGATCCCCAGACCTTCGAATTCACTCTAGTTTCCTAGTAAGGGGACAG
GTTTCAGAGATGGGCATTGCCTTGATGTTCCTGCTGGCCCTGTACCAGAT
GCAGTCGGCCATCCACAGCGAGATCATCGATACGCCCAACTATGCGGGCA
ACTCGTTGCAGGACGCTGACTCCGAGGTGAGTCCACCGCAGGACAATGAC
CTGGTAGATGCACTGCTCGGCAACGATCAGACCGAGAGGGCGGAGCTGGA
GTTCCGGCACCCCATCTCTGTGATTGGCATCGACTACTCGAAGAACGCCG
TGGTGCTGCACTTCCAGAAACACGGCCGGAAACCGCGCTACAAGTACGAT
CCCGAGCTGGAGGCCAAGCGAAGGTCCGTGCAGGACAACTTCATGCACTT
CGGCAAGAGGCAGGCGGAGCAGCTGCCACCGGAGGGCAGCTATGCTGAAT
CCGATGAACTGGAGGGCATGGCCAAGCGAGCAGCTATGGATCGGTATGGC
AGAGATCCCAAGCAGGACTTCATGCGGTTTGGTCGGGATCCGAAACAGGA
CTTCATGAGGTTTGGCAGGGATCCAAAGCAGGACTTCATGAGATTCGGTC
GGGATCCCAAGCAGGATTTCATGAGATTCGGTCGAGATCCCAAGCAGGAT
TTCATGAGGTTTGGACGCACTCCGGCTGAGGATTTCATGAGGTTCGGACG
CACTCCGGCGGAGGACTTCATGAGGTTCGGACGCTCCGACAATTTCATGC
GCTTCGGACGCAGTCCCCACGAGGAGCTTCGCAGTCCCAAACAGGATTTC
ATGCGATTCGGTCGCCCGGACAACTTCATGCGCTTCGGGCGTTCCGCTCC
GCAGGATTTTGTGCGCTCCGGGAAGATGGACTCAAACTTCATTCGATTCG
GTAAGAGCTTGAAGCCGGCGGCTCCCGAGTCCAAGCCAGTCAAGTCCAAT
CAAGGCAACCCAGGCGAACGCAGTCCAGTGGACAAGGCCATGACGGAGCT
GTTCAAGAAACAGGAGCTGCAGGATCAGCAGGTGAAGAACGGCGCACAGG
CGACCACCACGCAGGATGGGAGTGTGGAACAGGACCAGTTCTTCGGCCAG
TGAGGTAGTCCTGCGGGACGCCTCCTTGTAAATAGATATGGACAAATGTA
CGCAAGGATCTAAATTGATATACGTATATAACCCACTCCTCACACGAACT
CCTGACTTATGCCTGAACTATGAATTTTTAATGAATGGGCTGGATTAAAA
ATTCACCGTGCTTTGAAGTTCTTATCTATAAATATATCTAGTGTAATATT
GAAGAAATTGAAATTGGCGTGAATAAAATCCTGTGGCAACATTTTAAATA
AAGATTGCTTTACTGTAAATTATAGCGCAAAAAAAAAAAAAAA

RH02452.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
Fmrf.a 2065 Fmrf.a 632..2059 2..1429 7140 100 Plus
Fmrf-RA 1579 Fmrf-RA 146..1573 2..1429 7140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5796640..5797960 108..1428 6515 99.5 Plus
chr2R 21145070 chr2R 5797119..5797316 554..751 570 85.9 Plus
chr2R 21145070 chr2R 5797086..5797283 587..784 570 85.9 Plus
chr2R 21145070 chr2R 5793799..5793906 2..109 540 100 Plus
chr2R 21145070 chr2R 5797141..5797316 543..718 310 78.4 Plus
chr2R 21145070 chr2R 5797075..5797250 609..784 310 78.4 Plus
chr2R 21145070 chr2R 5797086..5797147 653..714 190 87.1 Plus
chr2R 21145070 chr2R 5797185..5797246 554..615 190 87.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9909137..9910458 108..1429 6610 100 Plus
2R 25286936 2R 9909583..9909780 587..784 570 85.9 Plus
2R 25286936 2R 9909616..9909813 554..751 570 85.9 Plus
2R 25286936 2R 9906294..9906401 2..109 540 100 Plus
2R 25286936 2R 9909572..9909747 609..784 310 78.4 Plus
2R 25286936 2R 9909638..9909813 543..718 310 78.4 Plus
2R 25286936 2R 9909583..9909644 653..714 190 87.1 Plus
2R 25286936 2R 9909682..9909743 554..615 190 87.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9910336..9911657 108..1429 6610 100 Plus
2R 25260384 2R 9907493..9907600 2..109 540 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:17:28 has no hits.

RH02452.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:18:09 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5793798..5793906 1..109 99 -> Plus
chr2R 5796642..5797960 110..1428 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:26 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
Fmrf-RA 1..1044 110..1153 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:55 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
Fmrf-RA 1..1044 110..1153 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:08:02 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
FMRFa-RA 1..1044 110..1153 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:16 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
Fmrf-RA 1..1044 110..1153 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:39 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
FMRFa-RA 1..1044 110..1153 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:17 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
Fmrf-RA 3..1430 1..1428 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:55 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
Fmrf-RA 3..1430 1..1428 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:08:02 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
FMRFa-RA 1..1427 2..1428 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:16 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
Fmrf-RA 3..1430 1..1428 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:39 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
FMRFa-RA 1..1427 2..1428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:09 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9906293..9906401 1..109 99 -> Plus
2R 9909139..9910457 110..1428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:09 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9906293..9906401 1..109 99 -> Plus
2R 9909139..9910457 110..1428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:09 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9906293..9906401 1..109 99 -> Plus
2R 9909139..9910457 110..1428 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:08:02 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5793798..5793906 1..109 99 -> Plus
arm_2R 5796644..5797962 110..1428 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:02 Download gff for RH02452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9910338..9911656 110..1428 100   Plus
2R 9907492..9907600 1..109 99 -> Plus

RH02452.hyp Sequence

Translation from 0 to 1152

> RH02452.hyp
TELFHLRAGNKCVCGPKGSPDLRIHSSFLVRGQVSEMGIALMFLLALYQM
QSAIHSEIIDTPNYAGNSLQDADSEVSPPQDNDLVDALLGNDQTERAELE
FRHPISVIGIDYSKNAVVLHFQKHGRKPRYKYDPELEAKRRSVQDNFMHF
GKRQAEQLPPEGSYAESDELEGMAKRAAMDRYGRDPKQDFMRFGRDPKQD
FMRFGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRTPAEDFMRFGR
TPAEDFMRFGRSDNFMRFGRSPHEELRSPKQDFMRFGRPDNFMRFGRSAP
QDFVRSGKMDSNFIRFGKSLKPAAPESKPVKSNQGNPGERSPVDKAMTEL
FKKQELQDQQVKNGAQATTTQDGSVEQDQFFGQ*

RH02452.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
FMRFa-PA 347 CG2346-PA 1..347 37..383 1838 100 Plus

RH02452.pep Sequence

Translation from 109 to 1152

> RH02452.pep
MGIALMFLLALYQMQSAIHSEIIDTPNYAGNSLQDADSEVSPPQDNDLVD
ALLGNDQTERAELEFRHPISVIGIDYSKNAVVLHFQKHGRKPRYKYDPEL
EAKRRSVQDNFMHFGKRQAEQLPPEGSYAESDELEGMAKRAAMDRYGRDP
KQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMRFGRDPKQDFMR
FGRTPAEDFMRFGRTPAEDFMRFGRSDNFMRFGRSPHEELRSPKQDFMRF
GRPDNFMRFGRSAPQDFVRSGKMDSNFIRFGKSLKPAAPESKPVKSNQGN
PGERSPVDKAMTELFKKQELQDQQVKNGAQATTTQDGSVEQDQFFGQ*

RH02452.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13563-PA 308 GF13563-PA 1..308 1..347 983 62.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24119-PA 349 GG24119-PA 1..349 1..347 1654 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20248-PA 421 GH20248-PA 1..380 1..318 988 58.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
FMRFa-PA 347 CG2346-PA 1..347 1..347 1838 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19418-PA 335 GI19418-PA 1..298 1..317 852 56.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:31:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16762-PA 353 GL16762-PA 1..353 1..347 1170 70.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15356-PA 353 GA15356-PA 1..353 1..347 1172 70.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21167-PA 345 GM21167-PA 1..345 1..347 1739 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10699-PA 347 GD10699-PA 1..347 1..347 1766 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Fmrf-PA 346 GJ22482-PA 1..342 1..341 846 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15742-PA 339 GK15742-PA 1..338 1..346 1056 64.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19316-PA 474 GE19316-PA 132..474 1..347 1710 94.5 Plus