Clone RH02566 Report

Search the DGRC for RH02566

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:25
Well:66
Vector:pFlc-1
Associated Gene/TranscriptCG31313-RA
Protein status:RH02566.pep: gold
Sequenced Size:482

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31313 2001-12-13 Blastp of sequenced clone
CG8087 2002-01-01 Sim4 clustering to Release 2
CG31313 2003-01-01 Sim4 clustering to Release 3
CG31313 2008-04-29 Release 5.5 accounting
CG31313 2008-08-15 Release 5.9 accounting
CG31313 2008-12-18 5.12 accounting

Clone Sequence Records

RH02566.complete Sequence

482 bp (482 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070641

> RH02566.complete
TCAGTTTGGAACAAGTGTTTCGAGGGAAATGCAGTCCGTGAAAGTGATCT
TTGTTCTGTCTGTGACCCTGGCGGTTGCCTTTGCTAACCCGAGGTTGCCG
CCCGGTGCCCCGAAGCCGCTGGATGGAGATGACTTATCCAAGGCTAAGGA
GCTCTTGGACACAACGCTCGCCAAACTTGCCACAGGAGATGGTCCCAATT
ATCAGGTAGTGAATGTGATCTCGGCATCTAGCCAACTGGTGGCTGGGTCG
CTCTACAAATTCGAGGTGAAGCTGTCCAACGGAGCCGAGACCAAGGAGTG
CAACGTAAAGATCTGGGACAGGCCATGGCTGCATGAGCAGGGGGAGGCCA
CCAATGTGAAGGTCCAGTGCAAGGATGAAGATGTGCTCGAGAAGACCTGG
TAGGGCGTCATTGCTGTGTTTAACCATACAATTTGCAATACAATAAAGGT
GCAATCTCTGGTGCTTGAAAAAAAAAAAAAAA

RH02566.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG31313-RA 819 CG31313-RA 97..568 1..472 2345 99.7 Plus
CG31313.a 649 CG31313.a 223..490 205..472 1325 99.6 Plus
CG31313.a 649 CG31313.a 1..204 1..204 1020 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10391500..10391762 467..205 1315 100 Minus
chr3R 27901430 chr3R 10391920..10392036 205..89 585 100 Minus
chr3R 27901430 chr3R 10392095..10392182 88..1 440 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14566739..14567006 472..205 1325 99.6 Minus
3R 32079331 3R 14567164..14567280 205..89 585 100 Minus
3R 32079331 3R 14567339..14567426 88..1 440 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14307570..14307837 472..205 1325 99.6 Minus
3R 31820162 3R 14307995..14308111 205..89 585 100 Minus
3R 31820162 3R 14308170..14308257 88..1 440 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:52:46 has no hits.

RH02566.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:53:41 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10391500..10391762 205..467 100 <- Minus
chr3R 10391921..10392036 89..204 100 <- Minus
chr3R 10392095..10392182 1..88 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:28 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..375 29..403 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:14 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..375 29..403 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:03 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..375 29..403 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:52 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..375 29..403 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:03 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..375 29..403 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:56 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..467 1..467 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:14 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..467 1..467 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:03 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 4..470 1..467 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:52 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 1..467 1..467 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:03 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
CG31313-RA 4..470 1..467 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:41 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14567339..14567426 1..88 100   Minus
3R 14566744..14567006 205..467 100 <- Minus
3R 14567165..14567280 89..204 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:41 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14567339..14567426 1..88 100   Minus
3R 14566744..14567006 205..467 100 <- Minus
3R 14567165..14567280 89..204 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:41 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14567339..14567426 1..88 100   Minus
3R 14566744..14567006 205..467 100 <- Minus
3R 14567165..14567280 89..204 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:03 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10392466..10392728 205..467 100 <- Minus
arm_3R 10392887..10393002 89..204 100 <- Minus
arm_3R 10393061..10393148 1..88 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:56 Download gff for RH02566.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14307575..14307837 205..467 100 <- Minus
3R 14307996..14308111 89..204 100 <- Minus
3R 14308170..14308257 1..88 100   Minus

RH02566.hyp Sequence

Translation from 0 to 402

> RH02566.hyp
QFGTSVSREMQSVKVIFVLSVTLAVAFANPRLPPGAPKPLDGDDLSKAKE
LLDTTLAKLATGDGPNYQVVNVISASSQLVAGSLYKFEVKLSNGAETKEC
NVKIWDRPWLHEQGEATNVKVQCKDEDVLEKTW*

RH02566.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG31313-PB 124 CG31313-PB 1..124 10..133 641 100 Plus
CG31313-PA 124 CG31313-PA 1..124 10..133 641 100 Plus
CG31313-PC 59 CG31313-PC 1..59 10..68 297 100 Plus
Cys-PA 126 CG8050-PA 4..126 10..133 284 44.8 Plus
CG8066-PB 104 CG8066-PB 8..104 35..133 251 49.5 Plus

RH02566.pep Sequence

Translation from 28 to 402

> RH02566.pep
MQSVKVIFVLSVTLAVAFANPRLPPGAPKPLDGDDLSKAKELLDTTLAKL
ATGDGPNYQVVNVISASSQLVAGSLYKFEVKLSNGAETKECNVKIWDRPW
LHEQGEATNVKVQCKDEDVLEKTW*

RH02566.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17475-PA 119 GF17475-PA 22..119 25..124 292 56 Plus
Dana\GF17473-PA 134 GF17473-PA 15..118 12..118 202 40.2 Plus
Dana\GF15461-PA 125 GF15461-PA 27..121 26..122 190 42.9 Plus
Dana\GF17474-PA 94 GF17474-PA 8..94 26..124 182 42.4 Plus
Dana\GF16067-PA 620 GF16067-PA 195..284 26..121 146 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21229-PA 124 GG21229-PA 1..124 1..124 591 89.5 Plus
Dere\GG21208-PA 126 GG21208-PA 1..126 1..124 286 46.1 Plus
Dere\GG21219-PA 105 GG21219-PA 8..105 26..124 269 51.5 Plus
Dere\GG18301-PA 122 GG18301-PA 1..113 1..117 190 36.4 Plus
Dere\GG11133-PA 615 GG11133-PA 188..279 26..121 141 33 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14131-PA 120 GH14131-PA 1..111 1..116 256 46.6 Plus
Dgri\GH14129-PA 122 GH14129-PA 4..122 7..124 228 41.3 Plus
Dgri\GH14128-PA 107 GH14128-PA 10..107 26..124 219 50 Plus
Dgri\GH14130-PA 132 GH14130-PA 13..132 8..124 205 36.9 Plus
Dgri\GH17753-PA 124 GH17753-PA 1..116 1..117 195 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG31313-PB 124 CG31313-PB 1..124 1..124 641 100 Plus
CG31313-PA 124 CG31313-PA 1..124 1..124 641 100 Plus
CG31313-PC 59 CG31313-PC 1..59 1..59 297 100 Plus
Cys-PA 126 CG8050-PA 4..126 1..124 284 44.8 Plus
CG8066-PB 104 CG8066-PB 8..104 26..124 251 49.5 Plus
CG8066-PA 104 CG8066-PA 8..104 26..124 251 49.5 Plus
CG15369-PB 122 CG15369-PB 6..116 7..120 188 37.4 Plus
CG15369-PA 122 CG15369-PA 6..116 7..120 188 37.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10663-PA 119 GI10663-PA 1..116 1..122 256 41.8 Plus
Dmoj\GI10660-PA 119 GI10660-PA 1..116 1..122 244 42.6 Plus
Dmoj\GI10664-PA 116 GI10664-PA 1..113 4..122 234 42 Plus
Dmoj\GI10659-PA 124 GI10659-PA 6..124 7..124 229 44.6 Plus
Dmoj\GI15508-PA 122 GI15508-PA 3..116 4..120 224 43.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24172-PA 122 GL24172-PA 1..122 1..124 369 55.2 Plus
Dper\GL24171-PA 127 GL24171-PA 1..127 1..124 285 45 Plus
Dper\GL22196-PA 627 GL22196-PA 195..289 23..121 183 39.6 Plus
Dper\GL26833-PA 137 GL26833-PA 1..132 1..123 174 37.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26524-PA 122 GA26524-PA 1..122 1..124 376 56 Plus
Dpse\GA20790-PA 127 GA20790-PA 1..127 1..124 284 45 Plus
Dpse\GA27408-PB 477 GA27408-PB 45..139 23..121 183 39.6 Plus
Dpse\GA27408-PA 629 GA27408-PA 197..291 23..121 183 39.6 Plus
Dpse\GA13677-PA 137 GA13677-PA 6..132 5..123 175 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25833-PA 124 GM25833-PA 1..124 1..124 604 93.5 Plus
Dsec\GM25843-PA 124 GM25843-PA 1..124 1..124 604 93.5 Plus
Dsec\GM25841-PA 123 GM25841-PA 1..123 1..124 276 44 Plus
Dsec\GM26669-PA 123 GM26669-PA 1..123 1..124 276 44 Plus
Dsec\GM26670-PA 105 GM26670-PA 8..105 26..124 272 52 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20414-PA 124 GD20414-PA 1..124 1..124 606 93.5 Plus
Dsim\GD20412-PA 123 GD20412-PA 1..123 1..124 282 44.8 Plus
Dsim\GD20413-PA 105 GD20413-PA 8..105 26..124 252 50 Plus
Dsim\GD16941-PA 122 GD16941-PA 6..100 7..101 195 42.7 Plus
Dsim\GD19635-PA 359 GD19635-PA 188..279 26..121 143 33 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23017-PA 126 GJ23017-PA 1..126 1..124 248 43 Plus
Dvir\GJ23015-PA 110 GJ23015-PA 9..110 23..124 220 46.2 Plus
Dvir\GJ19267-PA 122 GJ19267-PA 1..107 1..108 187 39.4 Plus
Dvir\GJ11017-PA 599 GJ11017-PA 170..257 23..113 164 41.9 Plus
Dvir\GJ23016-PA 165 GJ23016-PA 5..122 2..120 140 28.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11742-PA 128 GK11742-PA 1..128 1..124 265 45.4 Plus
Dwil\GK11350-PA 124 GK11350-PA 1..124 1..124 264 46 Plus
Dwil\GK11352-PA 120 GK11352-PA 1..112 1..117 256 46.6 Plus
Dwil\GK25384-PA 129 GK25384-PA 1..122 1..123 204 38.9 Plus
Dwil\GK11349-PA 106 GK11349-PA 9..101 26..118 166 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26442-PA 124 GE26442-PA 1..124 1..124 579 86.3 Plus
Dyak\Cys-PA 123 GE26440-PA 1..123 1..124 268 44 Plus
Dyak\GE26441-PA 105 GE26441-PA 8..105 26..124 259 51.5 Plus