Clone RH02620 Report

Search the DGRC for RH02620

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:26
Well:20
Vector:pFlc-1
Associated Gene/TranscriptCG10680-RA
Protein status:RH02620.pep: gold
Preliminary Size:793
Sequenced Size:1041

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10680 2001-12-17 Blastp of sequenced clone
CG10680 2002-01-01 Sim4 clustering to Release 2
CG10680 2003-01-01 Sim4 clustering to Release 3
CG10680 2008-04-29 Release 5.5 accounting
CG10680 2008-08-15 Release 5.9 accounting
CG10680 2008-12-18 5.12 accounting

Clone Sequence Records

RH02620.complete Sequence

1041 bp (1041 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071671

> RH02620.complete
GATAGTTCTGTCGATCGTCGGAAGTTCGAGACGTGAGTGTCAGTCGAGAT
CTGCGAGATGTTGCCGCTCCAATTCGTTTTGCTGGGCTGTCTGTTCATCG
CTCAGGGGATATGCCACACTCTGCCGGATCCCAAGCTAAGGGTGCCTCGT
GAAACTATCAACATTCCCACGCATCTCTTCAAGCCAGTGAGTCCGAAATC
GAGCAACAAACCTATTTCTAATAGATCATCCTTAAATGGCGGAAACAGCT
CTGCCCTGGCCGAAGCAAATAACGATGTCGAGTTTCTAGAGAGATCTAGC
GGTGAAGTGGAGGAGGTGACCGACACCTACGAAGAGGAGGACGTTCCACT
CCGACCTATCCCCTTCCAACCTCGACCGTTTTATCCTCAGATCCCTCCCC
GATCCAACGGTTTCCCCATTCGTCAACCCAACTATGACAATGCATTCCAA
ACCGATTACAATGTGGGTCCCAGAGGCAGCGGCTTCGACAACAGACCTTT
TCCCAGTTCCCCGGATTTCCGTGGCAGAGGCATTCGACCAATTCCTGACT
CCCCATTCCGCAATCAAAACTTAGGAACCTTTGTATCTCGACCGGTACCT
ATGCCATCCAGTGGTTCCATTATCCCCCTTATCGCCGGTGGTTCCAGTAT
TCCGACTGGTAGAAGTGGTCCCCTTGGTTCCGGGGGCTCTTCTAACAACT
TTTACCGGAGCGAATCCTATAGCTACACATCGGATGGAAGAGGACCTCCC
CAAATCGAGCGGGATGTGTTCGACTCGCGGGATGGATTTGGATCATCTTA
TCGCAACTTTTAACACCTTTCCTAAGAGAAGCTGATGAATGAAAGTTCCG
AGTTCTCAAAAACAACTAGTTAAGGCTGCTAGAGATTATACTGACTTGTC
TGTGTGTAATGTAAAGATTCTTGGCATTACAAATAATCAGTTATTTTACT
TTCCGCACGGTTTATTTATCAGACTAAATAACAATTGTATTGAATAGAAA
GTCAGTAAAACTTTCAAGGCTATTGAAAAAAAAAAAAAAAA

RH02620.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG10680-RA 1351 CG10680-RA 51..1077 2..1028 5120 99.9 Plus
CG10680.a 1291 CG10680.a 3..586 2..585 2920 100 Plus
CG10680.a 1291 CG10680.a 584..1017 595..1028 2155 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19963412..19963843 594..1025 2055 98.4 Plus
chr2L 23010047 chr2L 19963190..19963363 424..597 870 100 Plus
chr2L 23010047 chr2L 19962774..19962931 134..291 790 100 Plus
chr2L 23010047 chr2L 19962992..19963125 290..423 670 100 Plus
chr2L 23010047 chr2L 19962525..19962631 2..108 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19965062..19965496 594..1028 2160 99.8 Plus
2L 23513712 2L 19964840..19965013 424..597 870 100 Plus
2L 23513712 2L 19964424..19964581 134..291 790 100 Plus
2L 23513712 2L 19964642..19964775 290..423 670 100 Plus
2L 23513712 2L 19964175..19964281 2..108 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19965062..19965496 594..1028 2160 99.7 Plus
2L 23513712 2L 19964840..19965013 424..597 870 100 Plus
2L 23513712 2L 19964424..19964581 134..291 790 100 Plus
2L 23513712 2L 19964642..19964775 290..423 670 100 Plus
2L 23513712 2L 19964175..19964281 2..108 535 100 Plus
2L 23513712 2L 19964338..19964370 108..140 150 96.9 Plus
Blast to na_te.dros performed on 2019-03-16 19:41:34 has no hits.

RH02620.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:42:27 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19962524..19962631 1..108 99 -> Plus
chr2L 19962689..19962715 109..135 100 -> Plus
chr2L 19962776..19962931 136..291 100 -> Plus
chr2L 19962994..19963125 292..423 100 -> Plus
chr2L 19963190..19963360 424..594 100 -> Plus
chr2L 19963413..19963843 595..1025 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:30 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 1..756 58..813 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:26 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 1..756 58..813 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:00 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 1..756 58..813 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:11 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 1..756 58..813 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:39:33 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 1..756 58..813 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:00 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 2..1025 2..1025 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:26 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 2..1026 1..1025 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:00 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 2..1026 1..1025 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:11 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 2..1025 2..1025 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:39:33 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
CG10680-RA 2..1026 1..1025 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:27 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19964174..19964281 1..108 99 -> Plus
2L 19964339..19964365 109..135 100 -> Plus
2L 19964426..19964581 136..291 100 -> Plus
2L 19964644..19964775 292..423 100 -> Plus
2L 19964840..19965010 424..594 100 -> Plus
2L 19965063..19965493 595..1025 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:27 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19964174..19964281 1..108 99 -> Plus
2L 19964339..19964365 109..135 100 -> Plus
2L 19964426..19964581 136..291 100 -> Plus
2L 19964644..19964775 292..423 100 -> Plus
2L 19964840..19965010 424..594 100 -> Plus
2L 19965063..19965493 595..1025 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:27 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19964174..19964281 1..108 99 -> Plus
2L 19964339..19964365 109..135 100 -> Plus
2L 19964426..19964581 136..291 100 -> Plus
2L 19964644..19964775 292..423 100 -> Plus
2L 19964840..19965010 424..594 100 -> Plus
2L 19965063..19965493 595..1025 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:00 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19964840..19965010 424..594 100 -> Plus
arm_2L 19964174..19964281 1..108 99 -> Plus
arm_2L 19964339..19964365 109..135 100 -> Plus
arm_2L 19964426..19964581 136..291 100 -> Plus
arm_2L 19964644..19964775 292..423 100 -> Plus
arm_2L 19965063..19965493 595..1025 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:20 Download gff for RH02620.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19965063..19965493 595..1025 99   Plus
2L 19964174..19964281 1..108 99 -> Plus
2L 19964339..19964365 109..135 100 -> Plus
2L 19964426..19964581 136..291 100 -> Plus
2L 19964644..19964775 292..423 100 -> Plus
2L 19964840..19965010 424..594 100 -> Plus

RH02620.pep Sequence

Translation from 57 to 812

> RH02620.pep
MLPLQFVLLGCLFIAQGICHTLPDPKLRVPRETINIPTHLFKPVSPKSSN
KPISNRSSLNGGNSSALAEANNDVEFLERSSGEVEEVTDTYEEEDVPLRP
IPFQPRPFYPQIPPRSNGFPIRQPNYDNAFQTDYNVGPRGSGFDNRPFPS
SPDFRGRGIRPIPDSPFRNQNLGTFVSRPVPMPSSGSIIPLIAGGSSIPT
GRSGPLGSGGSSNNFYRSESYSYTSDGRGPPQIERDVFDSRDGFGSSYRN
F*

RH02620.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14442-PA 265 GF14442-PA 5..262 2..249 282 36.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21215-PA 251 GG21215-PA 1..251 1..251 986 80.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG10680-PB 251 CG10680-PB 1..251 1..251 1343 100 Plus
CG10680-PA 251 CG10680-PA 1..251 1..251 1343 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26333-PA 253 GL26333-PA 1..248 7..247 225 39 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28819-PA 253 GA28819-PA 1..248 7..247 231 38.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17385-PA 251 GM17385-PA 1..251 1..251 1102 91.6 Plus
Dsec\GM13585-PA 72 GM13585-PA 1..72 180..251 254 90.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24238-PA 251 GD24238-PA 1..251 1..251 1122 93.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13676-PA 236 GJ13676-PA 11..236 8..251 229 35.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14933-PA 61 GK14933-PA 19..61 209..251 154 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13290-PA 251 GE13290-PA 1..251 1..251 997 81.7 Plus

RH02620.hyp Sequence

Translation from 57 to 812

> RH02620.hyp
MLPLQFVLLGCLFIAQGICHTLPDPKLRVPRETINIPTHLFKPVSPKSSN
KPISNRSSLNGGNSSALAEANNDVEFLERSSGEVEEVTDTYEEEDVPLRP
IPFQPRPFYPQIPPRSNGFPIRQPNYDNAFQTDYNVGPRGSGFDNRPFPS
SPDFRGRGIRPIPDSPFRNQNLGTFVSRPVPMPSSGSIIPLIAGGSSIPT
GRSGPLGSGGSSNNFYRSESYSYTSDGRGPPQIERDVFDSRDGFGSSYRN
F*

RH02620.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10680-PB 251 CG10680-PB 1..251 1..251 1343 100 Plus
CG10680-PA 251 CG10680-PA 1..251 1..251 1343 100 Plus