RH02620.complete Sequence
1041 bp (1041 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071671
> RH02620.complete
GATAGTTCTGTCGATCGTCGGAAGTTCGAGACGTGAGTGTCAGTCGAGAT
CTGCGAGATGTTGCCGCTCCAATTCGTTTTGCTGGGCTGTCTGTTCATCG
CTCAGGGGATATGCCACACTCTGCCGGATCCCAAGCTAAGGGTGCCTCGT
GAAACTATCAACATTCCCACGCATCTCTTCAAGCCAGTGAGTCCGAAATC
GAGCAACAAACCTATTTCTAATAGATCATCCTTAAATGGCGGAAACAGCT
CTGCCCTGGCCGAAGCAAATAACGATGTCGAGTTTCTAGAGAGATCTAGC
GGTGAAGTGGAGGAGGTGACCGACACCTACGAAGAGGAGGACGTTCCACT
CCGACCTATCCCCTTCCAACCTCGACCGTTTTATCCTCAGATCCCTCCCC
GATCCAACGGTTTCCCCATTCGTCAACCCAACTATGACAATGCATTCCAA
ACCGATTACAATGTGGGTCCCAGAGGCAGCGGCTTCGACAACAGACCTTT
TCCCAGTTCCCCGGATTTCCGTGGCAGAGGCATTCGACCAATTCCTGACT
CCCCATTCCGCAATCAAAACTTAGGAACCTTTGTATCTCGACCGGTACCT
ATGCCATCCAGTGGTTCCATTATCCCCCTTATCGCCGGTGGTTCCAGTAT
TCCGACTGGTAGAAGTGGTCCCCTTGGTTCCGGGGGCTCTTCTAACAACT
TTTACCGGAGCGAATCCTATAGCTACACATCGGATGGAAGAGGACCTCCC
CAAATCGAGCGGGATGTGTTCGACTCGCGGGATGGATTTGGATCATCTTA
TCGCAACTTTTAACACCTTTCCTAAGAGAAGCTGATGAATGAAAGTTCCG
AGTTCTCAAAAACAACTAGTTAAGGCTGCTAGAGATTATACTGACTTGTC
TGTGTGTAATGTAAAGATTCTTGGCATTACAAATAATCAGTTATTTTACT
TTCCGCACGGTTTATTTATCAGACTAAATAACAATTGTATTGAATAGAAA
GTCAGTAAAACTTTCAAGGCTATTGAAAAAAAAAAAAAAAA
RH02620.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:36:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10680-RA | 1351 | CG10680-RA | 51..1077 | 2..1028 | 5120 | 99.9 | Plus |
CG10680.a | 1291 | CG10680.a | 3..586 | 2..585 | 2920 | 100 | Plus |
CG10680.a | 1291 | CG10680.a | 584..1017 | 595..1028 | 2155 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:41:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 19963412..19963843 | 594..1025 | 2055 | 98.4 | Plus |
chr2L | 23010047 | chr2L | 19963190..19963363 | 424..597 | 870 | 100 | Plus |
chr2L | 23010047 | chr2L | 19962774..19962931 | 134..291 | 790 | 100 | Plus |
chr2L | 23010047 | chr2L | 19962992..19963125 | 290..423 | 670 | 100 | Plus |
chr2L | 23010047 | chr2L | 19962525..19962631 | 2..108 | 535 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:41:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19965062..19965496 | 594..1028 | 2160 | 99.8 | Plus |
2L | 23513712 | 2L | 19964840..19965013 | 424..597 | 870 | 100 | Plus |
2L | 23513712 | 2L | 19964424..19964581 | 134..291 | 790 | 100 | Plus |
2L | 23513712 | 2L | 19964642..19964775 | 290..423 | 670 | 100 | Plus |
2L | 23513712 | 2L | 19964175..19964281 | 2..108 | 535 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19965062..19965496 | 594..1028 | 2160 | 99.7 | Plus |
2L | 23513712 | 2L | 19964840..19965013 | 424..597 | 870 | 100 | Plus |
2L | 23513712 | 2L | 19964424..19964581 | 134..291 | 790 | 100 | Plus |
2L | 23513712 | 2L | 19964642..19964775 | 290..423 | 670 | 100 | Plus |
2L | 23513712 | 2L | 19964175..19964281 | 2..108 | 535 | 100 | Plus |
2L | 23513712 | 2L | 19964338..19964370 | 108..140 | 150 | 96.9 | Plus |
Blast to na_te.dros performed on 2019-03-16 19:41:34 has no hits.
RH02620.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:42:27 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 19962524..19962631 | 1..108 | 99 | -> | Plus |
chr2L | 19962689..19962715 | 109..135 | 100 | -> | Plus |
chr2L | 19962776..19962931 | 136..291 | 100 | -> | Plus |
chr2L | 19962994..19963125 | 292..423 | 100 | -> | Plus |
chr2L | 19963190..19963360 | 424..594 | 100 | -> | Plus |
chr2L | 19963413..19963843 | 595..1025 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:30 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 1..756 | 58..813 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:26 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 1..756 | 58..813 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:00 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 1..756 | 58..813 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:11 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 1..756 | 58..813 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:39:33 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 1..756 | 58..813 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:00 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 2..1025 | 2..1025 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:26 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 2..1026 | 1..1025 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:00 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 2..1026 | 1..1025 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:11 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 2..1025 | 2..1025 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:39:33 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10680-RA | 2..1026 | 1..1025 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:27 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19964174..19964281 | 1..108 | 99 | -> | Plus |
2L | 19964339..19964365 | 109..135 | 100 | -> | Plus |
2L | 19964426..19964581 | 136..291 | 100 | -> | Plus |
2L | 19964644..19964775 | 292..423 | 100 | -> | Plus |
2L | 19964840..19965010 | 424..594 | 100 | -> | Plus |
2L | 19965063..19965493 | 595..1025 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:27 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19964174..19964281 | 1..108 | 99 | -> | Plus |
2L | 19964339..19964365 | 109..135 | 100 | -> | Plus |
2L | 19964426..19964581 | 136..291 | 100 | -> | Plus |
2L | 19964644..19964775 | 292..423 | 100 | -> | Plus |
2L | 19964840..19965010 | 424..594 | 100 | -> | Plus |
2L | 19965063..19965493 | 595..1025 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:27 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19964174..19964281 | 1..108 | 99 | -> | Plus |
2L | 19964339..19964365 | 109..135 | 100 | -> | Plus |
2L | 19964426..19964581 | 136..291 | 100 | -> | Plus |
2L | 19964644..19964775 | 292..423 | 100 | -> | Plus |
2L | 19964840..19965010 | 424..594 | 100 | -> | Plus |
2L | 19965063..19965493 | 595..1025 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:00 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19964840..19965010 | 424..594 | 100 | -> | Plus |
arm_2L | 19964174..19964281 | 1..108 | 99 | -> | Plus |
arm_2L | 19964339..19964365 | 109..135 | 100 | -> | Plus |
arm_2L | 19964426..19964581 | 136..291 | 100 | -> | Plus |
arm_2L | 19964644..19964775 | 292..423 | 100 | -> | Plus |
arm_2L | 19965063..19965493 | 595..1025 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:20 Download gff for
RH02620.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19965063..19965493 | 595..1025 | 99 | | Plus |
2L | 19964174..19964281 | 1..108 | 99 | -> | Plus |
2L | 19964339..19964365 | 109..135 | 100 | -> | Plus |
2L | 19964426..19964581 | 136..291 | 100 | -> | Plus |
2L | 19964644..19964775 | 292..423 | 100 | -> | Plus |
2L | 19964840..19965010 | 424..594 | 100 | -> | Plus |
RH02620.pep Sequence
Translation from 57 to 812
> RH02620.pep
MLPLQFVLLGCLFIAQGICHTLPDPKLRVPRETINIPTHLFKPVSPKSSN
KPISNRSSLNGGNSSALAEANNDVEFLERSSGEVEEVTDTYEEEDVPLRP
IPFQPRPFYPQIPPRSNGFPIRQPNYDNAFQTDYNVGPRGSGFDNRPFPS
SPDFRGRGIRPIPDSPFRNQNLGTFVSRPVPMPSSGSIIPLIAGGSSIPT
GRSGPLGSGGSSNNFYRSESYSYTSDGRGPPQIERDVFDSRDGFGSSYRN
F*
RH02620.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:10:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14442-PA | 265 | GF14442-PA | 5..262 | 2..249 | 282 | 36.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:10:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21215-PA | 251 | GG21215-PA | 1..251 | 1..251 | 986 | 80.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10680-PB | 251 | CG10680-PB | 1..251 | 1..251 | 1343 | 100 | Plus |
CG10680-PA | 251 | CG10680-PA | 1..251 | 1..251 | 1343 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:10:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26333-PA | 253 | GL26333-PA | 1..248 | 7..247 | 225 | 39 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:10:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA28819-PA | 253 | GA28819-PA | 1..248 | 7..247 | 231 | 38.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:10:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17385-PA | 251 | GM17385-PA | 1..251 | 1..251 | 1102 | 91.6 | Plus |
Dsec\GM13585-PA | 72 | GM13585-PA | 1..72 | 180..251 | 254 | 90.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:10:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24238-PA | 251 | GD24238-PA | 1..251 | 1..251 | 1122 | 93.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:10:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ13676-PA | 236 | GJ13676-PA | 11..236 | 8..251 | 229 | 35.8 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:10:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK14933-PA | 61 | GK14933-PA | 19..61 | 209..251 | 154 | 72.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:10:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13290-PA | 251 | GE13290-PA | 1..251 | 1..251 | 997 | 81.7 | Plus |
RH02620.hyp Sequence
Translation from 57 to 812
> RH02620.hyp
MLPLQFVLLGCLFIAQGICHTLPDPKLRVPRETINIPTHLFKPVSPKSSN
KPISNRSSLNGGNSSALAEANNDVEFLERSSGEVEEVTDTYEEEDVPLRP
IPFQPRPFYPQIPPRSNGFPIRQPNYDNAFQTDYNVGPRGSGFDNRPFPS
SPDFRGRGIRPIPDSPFRNQNLGTFVSRPVPMPSSGSIIPLIAGGSSIPT
GRSGPLGSGGSSNNFYRSESYSYTSDGRGPPQIERDVFDSRDGFGSSYRN
F*
RH02620.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10680-PB | 251 | CG10680-PB | 1..251 | 1..251 | 1343 | 100 | Plus |
CG10680-PA | 251 | CG10680-PA | 1..251 | 1..251 | 1343 | 100 | Plus |