Clone RH03087 Report

Search the DGRC for RH03087

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:30
Well:87
Vector:pFlc-1
Associated Gene/TranscriptCG14407-RA
Protein status:RH03087.pep: gold
Sequenced Size:683

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14407 2002-01-01 Sim4 clustering to Release 2
CG14407 2002-11-12 Blastp of sequenced clone
CG14407 2003-01-01 Sim4 clustering to Release 3
CG14407 2008-04-29 Release 5.5 accounting
CG14407 2008-08-15 Release 5.9 accounting
CG14407 2008-12-18 5.12 accounting

Clone Sequence Records

RH03087.complete Sequence

683 bp (683 high quality bases) assembled on 2002-11-12

GenBank Submission: AY084192

> RH03087.complete
GATCGATACCTTTTTAGCTGACACTTGAACAGCACTTGTTTTATTAGATA
ATATTGCTAATATTATTATTACCTCGACCAAGTCGCTGCCGTCAAGATGA
ACCGAATTTGCCAGAGTCTCCGCCATCCGAGATACCAGATTCTCGCCACC
ACAGCACCGCAATCCCTGCTCACCCGCTTTCTTGCGGCGGATGCGGCCAC
CGGCGCGGCAGTGGACAAGGCGACAATGGACAAGCTGGTGCGCACCAACA
AGGTGGTCGTCTTCATGAAGGGCAACCCACAGGCGCCACGCTGCGGCTTC
AGCAATGCGGTGGTGCAGATTATGCGGATGCACGGTGTCCAGTACGATGC
CCACGATGTGCTGCAAAACGAGTCCCTGCGACAGGGTGTCAAGGACTACA
CCGACTGGCCGACCATTCCGCAGGTGTTCATCAATGGCGAATTTGTCGGC
GGTTGCGACATCCTGCTGCAGATGCACCAGAGCGGCGATCTCATCGAGGA
GCTCAAGAAGGCGGGCATCATTTCGGAGCTGCTGAAAGCGGAGGAGGCTA
AGCAGCAGGACGACAAGGCTAAGTGATGATTCAAAAAGAGCGCCCAAAGA
TCAAATTCCCTTCCTAAATCTGTTAGTCACGCAACGTTTTTATTATTAAA
TGTTTAACTCATAACGACAAAAAAAAAAAAAAA

RH03087.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG14407-RA 842 CG14407-RA 53..721 2..670 3345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14728047..14728433 388..2 1935 100 Minus
chrX 22417052 chrX 14727707..14727990 668..385 1420 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14837811..14838197 388..2 1935 100 Minus
X 23542271 X 14837469..14837754 670..385 1430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14845909..14846295 388..2 1935 100 Minus
X 23527363 X 14845567..14845852 670..385 1430 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:07:13 has no hits.

RH03087.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:08:06 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14727707..14727989 386..668 100 <- Minus
chrX 14728050..14728433 1..385 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:38 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:05:01 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:06 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:55:10 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:58:24 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..480 97..576 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:24:26 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..667 2..668 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:05:01 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..667 2..668 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:06 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 2..668 2..668 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:55:10 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 1..667 2..668 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:58:24 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
CG14407-RA 2..668 2..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:06 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
X 14837471..14837753 386..668 100 <- Minus
X 14837814..14838197 1..385 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:06 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
X 14837471..14837753 386..668 100 <- Minus
X 14837814..14838197 1..385 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:06 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
X 14837471..14837753 386..668 100 <- Minus
X 14837814..14838197 1..385 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:06 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14731504..14731786 386..668 100 <- Minus
arm_X 14731847..14732230 1..385 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:32 Download gff for RH03087.complete
Subject Subject Range Query Range Percent Splice Strand
X 14845569..14845851 386..668 100 <- Minus
X 14845912..14846295 1..385 99   Minus

RH03087.hyp Sequence

Translation from 96 to 575

> RH03087.hyp
MNRICQSLRHPRYQILATTAPQSLLTRFLAADAATGAAVDKATMDKLVRT
NKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGVKD
YTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLKAEE
AKQQDDKAK*

RH03087.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14407-PA 159 CG14407-PA 1..159 1..159 818 100 Plus
CG6523-PA 216 CG6523-PA 94..215 15..137 243 37.4 Plus

RH03087.pep Sequence

Translation from 96 to 575

> RH03087.pep
MNRICQSLRHPRYQILATTAPQSLLTRFLAADAATGAAVDKATMDKLVRT
NKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGVKD
YTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLKAEE
AKQQDDKAK*

RH03087.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19438-PA 175 GF19438-PA 1..166 1..153 582 73.5 Plus
Dana\GF23121-PA 216 GF23121-PA 125..215 47..137 235 42.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19444-PA 169 GG19444-PA 1..169 1..159 711 85.8 Plus
Dere\GG23842-PA 216 GG23842-PA 94..215 15..137 238 37.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24287-PA 143 GH24287-PA 3..138 14..152 615 82.3 Plus
Dgri\GH13459-PA 216 GH13459-PA 125..215 47..137 239 41.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14407-PA 159 CG14407-PA 1..159 1..159 818 100 Plus
CG6523-PA 216 CG6523-PA 94..215 15..137 243 37.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16412-PA 163 GI16412-PA 1..163 1..157 600 75.5 Plus
Dmoj\GI17213-PA 216 GI17213-PA 119..215 41..137 235 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27096-PA 171 GL27096-PA 1..165 1..156 604 72.5 Plus
Dper\GL26044-PA 216 GL26044-PA 114..215 35..137 246 41.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12959-PA 171 GA12959-PA 1..165 1..156 605 72.7 Plus
Dpse\GA19662-PA 216 GA19662-PA 114..215 35..137 247 41.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12034-PA 158 GM12034-PA 1..158 1..159 811 95 Plus
Dsec\GM10421-PA 216 GM10421-PA 94..215 15..137 239 37.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15835-PA 158 GD15835-PA 1..158 1..159 814 95.6 Plus
Dsim\GD23891-PA 216 GD23891-PA 94..215 15..137 233 36.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17033-PA 163 GJ17033-PA 1..162 1..159 599 75.8 Plus
Dvir\GJ17969-PA 216 GJ17969-PA 122..215 44..137 234 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18554-PA 166 GK18554-PA 1..166 1..159 620 72.5 Plus
Dwil\GK14839-PA 217 GK14839-PA 95..216 15..137 245 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16098-PA 169 GE16098-PA 1..169 1..159 706 85.2 Plus
Dyak\GE18647-PA 216 GE18647-PA 94..215 15..137 239 37.4 Plus