Clone RH03221 Report

Search the DGRC for RH03221

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:32
Well:21
Vector:pFlc-1
Associated Gene/TranscriptAcp1-RA
Protein status:RH03221.pep: gold
Sequenced Size:873

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7216 2002-01-01 Sim4 clustering to Release 2
CG31904 2002-05-16 Blastp of sequenced clone
Acp1 2008-04-29 Release 5.5 accounting
Acp1 2008-08-15 Release 5.9 accounting
Acp1 2008-12-18 5.12 accounting

Clone Sequence Records

RH03221.complete Sequence

873 bp (873 high quality bases) assembled on 2002-05-16

GenBank Submission: AY119158

> RH03221.complete
GATCAGTTCAGAACAAGAGTTCAACCAGAGCGCAACCCAAAACCCACAAA
CAGCACCATGAAATTCGCCGTCGCCGTTATCTTCACCTTGGCCCTCGCCA
TGGGCGTGCAGTCGTCTGTGATCCCCCTGCTGTCCCAGGTGGCTGGACAT
GGACTGTCCTACACCGCCGTTTCCGGACCCGCTGTGGTGGCCTCTCCCTG
GGCCGTTCCCGCCGCCCACTGGCCTGCTGCCGTGAACGTGGCTTCGTGGC
CTCCGGCAGCGATCCACGCCGCCGCTCCTGCCGTGCTTGCTGCCCCTGCT
CCCGCTGTGGTTGCTGCTCATGCTCCCTCAGTCGTCGTGGCCCCAGTGGC
TCACAGTGGCGTCTACACTGCCCAGACCCGTGGTGCCATTCACACCGCTC
CTCTGGCCGGACACATCCAGTCGGTGGCCTCCATCAATGCCGCTCCCGCA
CCCGGAACCTTGTAAGGAGTATACCGCCTTCAATCCCTTTGTCGATCGGA
CCATTGCCTCTGCCACGGATACTGCCATTGATGGGGAAGTCGAACTTTAG
ACCCCTCAACACGTTATGTAAATACATTGTATATATAGCCATATATAGAC
AGGGTACTCGCACCTAGCACCTGAACAGGATCCTTTCATACCTGTCCCGA
AAAAAAGGAGTCATCAAAATTCTCTTCCGACCTAAGCACCCGGCCACGTT
TGTGGTTGCCTATTTCTCTCGCTTACCTATTTATTTAGCATACATTTTCC
AAGCATCCTGTGAAAAAACCATCACAAGTTTTCTTCGAACGGAATGCCAA
GTGCATTCTGGAAGGAAATGCTTGTACATCTACATAATGCCAATAAAGAA
AATGTAACTAAAAAAAAAAAAAA

RH03221.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
Acp1-RA 1011 Acp1-RA 143..1004 1..862 4310 100 Plus
CG31904-RB 3562 CG31904-RB 3120..3554 428..862 2175 100 Plus
CG31904-RD 2030 CG31904-RD 1588..2022 428..862 2175 100 Plus
CG31904-RB 3562 CG31904-RB 2767..3121 64..418 1775 100 Plus
CG31904-RD 2030 CG31904-RD 1235..1589 64..418 1775 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7739660..7740455 859..64 3935 99.6 Minus
chr2L 23010047 chr2L 7733520..7734304 859..64 3780 98.6 Minus
chr2L 23010047 chr2L 7740574..7740636 63..1 315 100 Minus
chr2L 23010047 chr2L 7743305..7743401 466..370 185 79.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7740559..7741357 862..64 3995 100 Minus
2L 23513712 2L 7734419..7735206 862..64 3795 98.6 Minus
2L 23513712 2L 7741476..7741538 63..1 315 100 Minus
2L 23513712 2L 7744207..7744303 466..370 185 79.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7740559..7741357 862..64 3995 100 Minus
2L 23513712 2L 7734419..7734853 862..428 2175 100 Minus
2L 23513712 2L 7734852..7735206 418..64 1775 100 Minus
2L 23513712 2L 7741476..7741538 63..1 315 100 Minus
2L 23513712 2L 7744207..7744303 466..370 185 79.3 Minus
Blast to na_te.dros performed 2019-03-16 04:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 677..728 268..322 114 75 Plus

RH03221.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:17:23 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7739660..7740455 64..859 99 <- Minus
chr2L 7740574..7740636 1..63 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:41 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 1..408 58..465 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:50:18 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 1..408 58..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:45 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31904-RD 670..1212 64..617 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:42:53 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 1..408 58..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:33:39 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
CG31904-RD 670..1212 64..617 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:27:35 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 5..863 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:50:18 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 5..863 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:45 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 1..858 2..859 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:42:54 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 5..863 1..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:33:39 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
Acp1-RA 1..858 2..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:23 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7740562..7741357 64..859 100 <- Minus
2L 7741476..7741538 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:23 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7740562..7741357 64..859 100 <- Minus
2L 7741476..7741538 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:17:23 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7740562..7741357 64..859 100 <- Minus
2L 7741476..7741538 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:45 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7740562..7741357 64..859 100 <- Minus
arm_2L 7741476..7741538 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:15:14 Download gff for RH03221.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7740562..7741357 64..859 100 <- Minus
2L 7741476..7741538 1..63 100   Minus

RH03221.hyp Sequence

Translation from 2 to 616

> RH03221.hyp
SVQNKSSTRAQPKTHKQHHEIRRRRYLHLGPRHGRAVVCDPPAVPGGWTW
TVLHRRFRTRCGGLSLGRSRRPLACCRERGFVASGSDPRRRSCRACCPCS
RCGCCSCSLSRRGPSGSQWRLHCPDPWCHSHRSSGRTHPVGGLHQCRSRT
RNLVRSIPPSIPLSIGPLPLPRILPLMGKSNFRPLNTLCKYIVYIAIYRQ
GTRT*

RH03221.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31904-PB 403 CG31904-PB 329..403 132..204 332 88 Plus
CG31904-PD 403 CG31904-PD 329..403 132..204 332 88 Plus

RH03221.pep Sequence

Translation from 57 to 464

> RH03221.pep
MKFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAV
PAAHWPAAVNVASWPPAAIHAAAPAVLAAPAPAVVAAHAPSVVVAPVAHS
GVYTAQTRGAIHTAPLAGHIQSVASINAAPAPGTL*

RH03221.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14586-PA 134 GF14586-PA 1..134 1..135 316 81.5 Plus
Dana\GF14585-PA 145 GF14585-PA 1..145 1..135 172 40.1 Plus
Dana\GF14584-PA 138 GF14584-PA 1..138 1..135 150 46.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23512-PA 133 GG23512-PA 1..133 1..135 579 96.3 Plus
Dere\GG23510-PA 150 GG23510-PA 17..149 1..134 181 48.2 Plus
Dere\GG23511-PA 142 GG23511-PA 1..142 1..135 161 40.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10483-PA 136 GH10483-PA 1..136 1..135 428 81 Plus
Dgri\GH13216-PA 129 GH13216-PA 1..129 1..135 161 49.3 Plus
Dgri\GH10481-PA 147 GH10481-PA 110..147 98..135 138 68.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Acp1-PA 135 CG7216-PA 1..135 1..135 678 100 Plus
CG31904-PB 403 CG31904-PB 224..341 3..120 596 100 Plus
CG31904-PD 403 CG31904-PD 224..341 3..120 596 100 Plus
CG7203-PC 129 CG7203-PC 1..128 1..134 276 52.9 Plus
CG7203-PB 129 CG7203-PB 1..128 1..134 276 52.9 Plus
CG7214-PA 142 CG7214-PA 1..142 1..135 211 41.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18000-PA 144 GI18000-PA 1..144 1..135 463 72.4 Plus
Dmoj\GI17999-PA 142 GI17999-PA 1..142 1..135 160 40.1 Plus
Dmoj\GI14512-PA 125 GI14512-PA 1..125 1..135 132 49.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18854-PA 129 GL18854-PA 1..129 1..135 411 73.9 Plus
Dper\GL18852-PA 399 GL18852-PA 283..398 11..134 155 47.2 Plus
Dper\GL18853-PA 148 GL18853-PA 93..148 71..135 153 53.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25829-PA 136 GA25829-PA 1..136 1..135 393 71.1 Plus
Dpse\GA20178-PA 126 GA20178-PA 1..125 1..134 173 48.1 Plus
Dpse\GA20185-PA 148 GA20185-PA 93..148 71..135 153 53.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13384-PA 135 GM13384-PA 1..135 1..135 604 98.5 Plus
Dsec\GM13372-PA 142 GM13372-PA 1..142 1..135 161 40.4 Plus
Dsec\GM13361-PA 129 GM13361-PA 1..128 1..134 154 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22473-PA 135 GD22473-PA 1..135 1..135 604 98.5 Plus
Dsim\GD22472-PA 142 GD22472-PA 1..142 1..135 161 40.4 Plus
Dsim\GD22471-PA 145 GD22471-PA 17..144 1..134 157 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19615-PA 131 GJ19615-PA 1..131 1..135 448 79.3 Plus
Dvir\GJ19614-PA 142 GJ19614-PA 1..142 1..135 163 39.7 Plus
Dvir\GJ16283-PA 130 GJ16283-PA 1..129 1..134 138 46.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24644-PA 137 GK24644-PA 1..137 1..135 411 78.1 Plus
Dwil\GK24642-PA 146 GK24642-PA 1..146 1..135 194 47.4 Plus
Dwil\GK24643-PA 138 GK24643-PA 98..138 95..135 156 73.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18339-PA 135 GE18339-PA 1..135 1..135 606 98.5 Plus
Dyak\GE18338-PA 142 GE18338-PA 1..142 1..135 161 40.4 Plus
Dyak\GE18337-PA 138 GE18337-PA 1..137 1..134 143 39 Plus