Clone RH03254 Report

Search the DGRC for RH03254

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:32
Well:54
Vector:pFlc-1
Associated Gene/TranscriptCG15065-RA
Protein status:RH03254.pep: gold
Sequenced Size:233

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15065 2008-12-18 5.12 accounting

Clone Sequence Records

RH03254.complete Sequence

233 bp assembled on 2008-12-09

GenBank Submission: BT053752.1

> RH03254.complete
ATCAGTTTCATTTCAACCGTTGCCAACAATATGAAGTGGATGTCCTTGGT
CTTTCTATGCGGTCTGCTCGCCATGGCAGTGGCTTCTCCGTTAAATCCGG
GTAATGTCATTATCAATGGAGATTGCCGTCATTGTAATGTTCGCGGAGGC
TAAATTGGAGTTATAAAACTTTGATGTTTAGTAACTACAATAAAACTTAT
GAAAAATACAGATTGTGCAAAAAAAAAAAAAAA

RH03254.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15065-RA 354 CG15065-RA 79..301 1..223 1100 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14277153..14277289 82..218 670 99.3 Plus
chr2R 21145070 chr2R 14277006..14277087 1..82 410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18390106..18390247 82..223 695 99.3 Plus
2R 25286936 2R 18389959..18390040 1..82 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18391305..18391446 82..223 695 99.2 Plus
2R 25260384 2R 18391158..18391239 1..82 410 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:06:10 has no hits.

RH03254.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:06:52 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14277006..14277087 1..82 100 -> Plus
chr2R 14277154..14277289 83..218 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:03:55 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 1..123 31..153 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:21:52 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 1..123 31..153 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:13 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 1..123 31..153 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:55:34 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 1..123 31..153 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-09 13:59:26 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 2..219 1..218 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:21:52 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 2..219 1..218 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:13 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 1..218 1..218 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:55:34 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 1..218 1..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:52 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389959..18390040 1..82 100 -> Plus
2R 18390107..18390242 83..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:52 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389959..18390040 1..82 100 -> Plus
2R 18390107..18390242 83..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:06:52 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389959..18390040 1..82 100 -> Plus
2R 18390107..18390242 83..218 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:13 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14277464..14277545 1..82 100 -> Plus
arm_2R 14277612..14277747 83..218 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:53:32 Download gff for RH03254.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18391158..18391239 1..82 100 -> Plus
2R 18391306..18391441 83..218 100   Plus

RH03254.pep Sequence

Translation from 0 to 152

> RH03254.pep
ISFISTVANNMKWMSLVFLCGLLAMAVASPLNPGNVIINGDCRHCNVRGG
*

RH03254.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12155-PA 45 GF12155-PA 1..44 11..50 124 63.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:29:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21877-PA 39 GG21877-PA 1..39 11..49 147 71.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23858-PA 40 GH23858-PA 1..40 11..50 138 67.5 Plus
Dgri\GH21665-PA 40 GH21665-PA 1..40 11..50 127 62.5 Plus
Dgri\GH13934-PA 40 GH13934-PA 1..40 11..50 127 62.5 Plus
Dgri\GH20220-PA 39 GH20220-PA 1..38 11..49 125 64.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15065-PA 40 CG15065-PA 1..40 11..50 220 100 Plus
IM3-PB 39 CG16844-PB 1..38 11..48 154 76.3 Plus
IM3-PA 39 CG16844-PA 1..38 11..48 154 76.3 Plus
CG15068-PA 40 CG15068-PA 1..39 11..49 149 69.2 Plus
IM2-PA 45 CG18106-PA 1..44 11..50 126 61.4 Plus
IM1-PA 45 CG18108-PA 1..44 11..50 125 65.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20115-PA 45 GI20115-PA 1..44 11..50 123 61.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16705-PA 40 GL16705-PA 1..39 11..49 151 69.2 Plus
Dper\GL17765-PA 40 GL17765-PA 1..40 11..49 139 70 Plus
Dper\GL17764-PA 45 GL17764-PA 1..44 11..50 123 61.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30478-PA 40 GA30478-PA 1..39 11..49 151 69.2 Plus
Dpse\GA24904-PA 40 GA24904-PA 1..40 11..49 139 70 Plus
Dpse\GA14796-PA 45 GA14796-PA 1..44 11..50 123 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21872-PA 40 GM21872-PA 1..40 11..50 206 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11368-PA 40 GD11368-PA 1..35 11..45 165 91.4 Plus
Dsim\GD11366-PA 39 GD11366-PA 1..39 11..49 146 71.8 Plus
Dsim\GD11365-PA 45 GD11365-PA 1..44 11..50 123 61.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22451-PA 40 GJ22451-PA 1..39 11..49 145 69.2 Plus
Dvir\GJ19885-PA 45 GJ19885-PA 1..44 11..50 126 61.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23991-PA 40 GK23991-PA 1..39 11..49 160 71.8 Plus
Dwil\GK23235-PA 40 GK23235-PA 1..39 11..49 155 71.8 Plus
Dwil\GK23232-PA 68 GK23232-PA 1..44 11..50 125 61.4 Plus
Dwil\GK22977-PA 45 GK22977-PA 1..44 11..50 123 61.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11953-PA 40 GE11953-PA 1..40 11..50 188 90 Plus

RH03254.hyp Sequence

Translation from 0 to 152

> RH03254.hyp
ISFISTVANNMKWMSLVFLCGLLAMAVASPLNPGNVIINGDCRHCNVRGG
*

RH03254.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15065-PA 40 CG15065-PA 1..40 11..50 220 100 Plus
IM3-PB 39 CG16844-PB 1..38 11..48 154 76.3 Plus
IM3-PA 39 CG16844-PA 1..38 11..48 154 76.3 Plus
CG15068-PA 40 CG15068-PA 1..39 11..49 149 69.2 Plus
IM2-PA 45 CG18106-PA 1..44 11..50 126 61.4 Plus