Clone RH03295 Report

Search the DGRC for RH03295

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:32
Well:95
Vector:pFlc-1
Associated Gene/Transcriptlevy-RA
Protein status:RH03295.pep: gold
Sequenced Size:505

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17280 2001-12-13 Blastp of sequenced clone
CG17280 2002-01-01 Sim4 clustering to Release 2
CG17280 2003-01-01 Sim4 clustering to Release 3
CG17280 2008-04-29 Release 5.5 accounting
levy 2008-08-15 Release 5.9 accounting
levy 2008-12-18 5.12 accounting

Clone Sequence Records

RH03295.complete Sequence

505 bp (505 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070648

> RH03295.complete
TACTTGTCAAAACAGCAAATTTTCATTCGGGCCAAGAATCGACTGAAAAT
ATGTCCGCTATTCTAAACCACGCAATTCGCCGCCAATTCGGCGCTTCTGC
CGCCCGGAATATGTCCGGCACCGCCGCCGTGGCCGGCGAGCACTCTGGTG
GCTACAAGGTGTGGAAGCGCCTGTCCTTCTTCGTGGCCGTGCCCGCCGTG
GGACTGTGCATGCTGAACGCCTACCTGAAGCACCAGGAGGAGCACGACAA
GCCCCGCCAGGAGTTCGTCAAGTACGACTACCTGCGCCGCCGCGAGAAGC
GCTTCCCCTGGGGTGAGGGCCAGAAGAGCCTGTTCCACAACCCCCACGTT
AACGCCCTGCCCGACGGCTACGAGCACTAGGTGGCCACCGTCTCCGGTTC
CCTCTGCGGGATGTATTCGTTGTTTGGTAGTGTTAGACGTTAATGTAAAC
TGAACTTTACGCGGAAATACACAGAAAACACATATACCCAAAAAAAAAAA
AAAAA

RH03295.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
levy-RA 764 levy-RA 124..615 1..492 2445 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19434865..19435207 147..489 1685 99.4 Plus
chr2R 21145070 chr2R 19434568..19434716 1..149 745 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23548537..23548882 147..492 1715 99.7 Plus
2R 25286936 2R 23548240..23548388 1..149 745 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23549736..23550081 147..492 1715 99.7 Plus
2R 25260384 2R 23549439..23549587 1..149 745 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:38:07 has no hits.

RH03295.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:44 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19434568..19434714 1..147 100 -> Plus
chr2R 19434866..19435207 148..489 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:42 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..330 51..380 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:44 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..330 51..380 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:22:50 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..330 51..380 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:41:52 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..330 51..380 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:13 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..330 51..380 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:42 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..489 1..489 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:44 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..489 1..489 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:22:50 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 2..490 1..489 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:41:52 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 1..489 1..489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:13 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
levy-RA 2..490 1..489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:44 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23548240..23548386 1..147 100 -> Plus
2R 23548538..23548879 148..489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:44 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23548240..23548386 1..147 100 -> Plus
2R 23548538..23548879 148..489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:44 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23548240..23548386 1..147 100 -> Plus
2R 23548538..23548879 148..489 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:22:50 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19435763..19435909 1..147 100 -> Plus
arm_2R 19436061..19436402 148..489 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:49 Download gff for RH03295.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23549755..23550096 148..489 99   Plus
2R 23549457..23549603 1..147 100 -> Plus

RH03295.hyp Sequence

Translation from 2 to 379

> RH03295.hyp
LVKTANFHSGQESTENMSAILNHAIRRQFGASAARNMSGTAAVAGEHSGG
YKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKR
FPWGEGQKSLFHNPHVNALPDGYEH*

RH03295.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
levy-PB 109 CG17280-PB 1..109 17..125 590 100 Plus
levy-PA 109 CG17280-PA 1..109 17..125 590 100 Plus
CG30093-PA 94 CG30093-PA 19..87 53..124 234 56.9 Plus
CG14077-PB 289 CG14077-PB 153..229 43..124 141 36.1 Plus
CG14077-PC 289 CG14077-PC 153..229 43..124 141 36.1 Plus

RH03295.pep Sequence

Translation from 50 to 379

> RH03295.pep
MSAILNHAIRRQFGASAARNMSGTAAVAGEHSGGYKVWKRLSFFVAVPAV
GLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWGEGQKSLFHNPHV
NALPDGYEH*

RH03295.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13063-PA 109 GF13063-PA 1..109 1..109 552 92.7 Plus
Dana\GF11548-PA 97 GF11548-PA 21..85 37..104 212 54.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22865-PA 109 GG22865-PA 1..109 1..109 574 97.2 Plus
Dere\GG20553-PA 94 GG20553-PA 19..87 37..108 229 56.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21206-PA 109 GH21206-PA 1..109 1..109 531 89.9 Plus
Dgri\GH22053-PA 103 GH22053-PA 22..102 27..108 261 57.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
levy-PB 109 CG17280-PB 1..109 1..109 590 100 Plus
levy-PA 109 CG17280-PA 1..109 1..109 590 100 Plus
COX6AL-PA 94 CG30093-PA 19..87 37..108 234 56.9 Plus
CG14077-PB 289 CG14077-PB 153..229 27..108 141 36.1 Plus
CG14077-PC 289 CG14077-PC 153..229 27..108 141 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20495-PA 109 GI20495-PA 1..109 1..109 529 89.9 Plus
Dmoj\GI19139-PA 102 GI19139-PA 24..101 29..108 271 61.3 Plus
Dmoj\GI12974-PA 218 GI12974-PA 1..69 37..108 141 40.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16869-PA 109 GL16869-PA 1..109 1..109 566 96.3 Plus
Dper\GL19036-PA 149 GL19036-PA 32..105 33..108 145 40.3 Plus
Dper\GL19037-PA 226 GL19037-PA 37..131 12..108 137 33.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14437-PA 109 GA14437-PA 1..109 1..109 566 96.3 Plus
Dpse\GA25317-PA 221 GA25317-PA 104..177 33..108 143 40.3 Plus
Dpse\GA25318-PA 226 GA25318-PA 37..131 12..108 138 33.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16024-PA 109 GM16024-PA 1..109 1..109 583 99.1 Plus
Dsec\GM21645-PA 94 GM21645-PA 19..87 37..108 231 56.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15452-PA 109 GD15452-PA 1..109 1..109 578 98.2 Plus
Dsim\GD11145-PA 94 GD11145-PA 19..87 37..108 232 56.9 Plus
Dsim\CoVIa-PA 260 GD12318-PA 130..200 36..108 137 39.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22345-PA 109 GJ22345-PA 1..109 1..109 536 90.8 Plus
Dvir\GJ22272-PA 102 GJ22272-PA 14..101 15..108 267 51.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23279-PA 109 GK23279-PA 1..109 1..109 548 92.7 Plus
Dwil\GK22192-PA 96 GK22192-PA 1..95 13..109 253 49 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14301-PA 109 GE14301-PA 1..109 1..109 572 97.2 Plus
Dyak\GE11738-PA 94 GE11738-PA 19..87 37..108 235 58.3 Plus
Dyak\GE22798-PA 262 GE22798-PA 126..203 27..109 137 36.9 Plus
Dyak\GE22540-PA 262 GE22540-PA 126..203 27..109 136 36.9 Plus