Clone RH03540 Report

Search the DGRC for RH03540

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:35
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG15347-RA
Protein status:RH03540.pep: gold
Preliminary Size:824
Sequenced Size:936

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15347 2001-12-13 Blastp of sequenced clone
CG15347 2002-01-01 Sim4 clustering to Release 2
CG15347 2003-01-01 Sim4 clustering to Release 3
CG15347 2008-04-29 Release 5.5 accounting
CG15347 2008-08-15 Release 5.9 accounting
CG15347 2008-12-18 5.12 accounting

Clone Sequence Records

RH03540.complete Sequence

936 bp (936 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070650

> RH03540.complete
GAGTTCTGGTTCAGCTCCGTAACCAGTCGCAACATTCGATCGTCGTGAAA
TTAGTTACATCAGTTATCAGCCATGAAGTTTTACCTGTTGGTGATTGCAG
CCCTCTCGTTTTTGGCCTACATCAGTTGTGATGGATGCATCCAGTGCAAT
TCGAAGGACAACGAACGCTGCGCCACAGATCCATTGAGCCTGCTCAATCG
CAACTGTTCCGATGGATCCTCCAACTGCTATTCCCGCGTCCTGGATGGCT
ACACAATTCGCGGCTGTGCCGTCGATCTGGACAACGCCACGCGTAATTCG
TGCAACAACGAGCTACTGTGCCAGCTGTGCACCTACAGCGAGGGATGCAA
TCGAAACACCTTCCCGTTGAGCCGCCTCATGTGCCTACAGTGCACAGGGA
ACTCGACCTCGTCGTCCTGCGCCACAGAGACCTATGTATCGGCCAAGATC
TGCCCGCTGTACAAGTTCGGCGACAAGTGCTACATTCGCAATAGCAATCG
CACCGTGGACGGATCCTTCCAGCGCGGCTGTCTCACCTCGGCGAATGCCA
GGAAGCAGTGCGTCAAGGATGGCAACTGTTATACGTGCGAGGGACGCGGC
TGCAACTTTCTGCTGGCCAATGATACCAACATTCCGCTGGCACGCGACAG
CGGTGCCCAGTTGATCATCTCCATGACGCTGCTGATCAGCGGTCTTGTCG
CCGCCTGGAGACTCTAAGATGTAACGACGGCCAGAGTCGAATGATGGACG
AAAGTCAATCATGCCACAGACCCAGTTCTTTTAGAAATTCCCGTCTTATT
ATTTTCTACATTCTAAAACATCATTATACATACATACATACACTGGGATG
TTACATTTATACTCGTTTATTTCATTACTTTGAACAAAACGTTAATAAAG
ATAACTAAACTAAAGAAGACAAAAAAAAAAAAAAAA

RH03540.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-RA 1102 CG15347-RA 165..1088 2..925 4620 100 Plus
CG15347.a 1005 CG15347.a 196..991 130..925 3980 100 Plus
CG15347.a 1005 CG15347.a 23..151 2..130 645 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8350271..8350947 920..244 3370 99.9 Minus
chrX 22417052 chrX 8352544..8352672 130..2 645 100 Minus
chrX 22417052 chrX 8351001..8351115 244..130 575 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8458489..8459170 925..244 3410 100 Minus
X 23542271 X 8460766..8460894 130..2 645 100 Minus
X 23542271 X 8459224..8459338 244..130 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8466587..8467268 925..244 3410 100 Minus
X 23527363 X 8468864..8468992 130..2 645 100 Minus
X 23527363 X 8467322..8467436 244..130 575 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:52:52 has no hits.

RH03540.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:53:44 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8350271..8350946 245..920 99 <- Minus
chrX 8351001..8351114 131..244 100 <- Minus
chrX 8352544..8352672 1..130 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:48 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..645 73..717 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:37 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..645 73..717 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:08 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..645 73..717 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:47 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..645 73..717 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:10 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..645 73..717 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:38 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..919 2..920 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:37 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..919 2..920 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:08 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 4..923 1..920 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:47 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 1..919 2..920 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:10 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RA 4..923 1..920 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:44 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
X 8458494..8459169 245..920 100 <- Minus
X 8459224..8459337 131..244 100 <- Minus
X 8460766..8460894 1..130 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:44 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
X 8458494..8459169 245..920 100 <- Minus
X 8459224..8459337 131..244 100 <- Minus
X 8460766..8460894 1..130 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:53:44 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
X 8458494..8459169 245..920 100 <- Minus
X 8459224..8459337 131..244 100 <- Minus
X 8460766..8460894 1..130 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:08 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8352527..8353202 245..920 100 <- Minus
arm_X 8353257..8353370 131..244 100 <- Minus
arm_X 8354799..8354927 1..130 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:33 Download gff for RH03540.complete
Subject Subject Range Query Range Percent Splice Strand
X 8466592..8467267 245..920 100 <- Minus
X 8467322..8467435 131..244 100 <- Minus
X 8468864..8468992 1..130 99   Minus

RH03540.pep Sequence

Translation from 72 to 716

> RH03540.pep
MKFYLLVIAALSFLAYISCDGCIQCNSKDNERCATDPLSLLNRNCSDGSS
NCYSRVLDGYTIRGCAVDLDNATRNSCNNELLCQLCTYSEGCNRNTFPLS
RLMCLQCTGNSTSSSCATETYVSAKICPLYKFGDKCYIRNSNRTVDGSFQ
RGCLTSANARKQCVKDGNCYTCEGRGCNFLLANDTNIPLARDSGAQLIIS
MTLLISGLVAAWRL*

RH03540.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22583-PA 214 GF22583-PA 1..214 1..214 909 79 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19047-PA 214 GG19047-PA 1..214 1..214 980 85.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12232-PA 213 GH12232-PA 1..191 1..192 680 65.1 Plus
Dgri\GH20775-PA 2920 GH20775-PA 2741..2917 22..207 160 30.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-PA 214 CG15347-PA 1..214 1..214 1158 100 Plus
CG15347-PB 229 CG15347-PB 1..229 1..214 1132 93.4 Plus
CG13492-PD 2979 CG13492-PD 2799..2975 22..211 204 26.9 Plus
CG13492-PD 2979 CG13492-PD 1538..1695 22..178 184 31.7 Plus
CG13492-PD 2979 CG13492-PD 698..849 22..178 176 31.1 Plus
CG13492-PD 2979 CG13492-PD 1963..2114 22..178 176 32.7 Plus
CG13492-PD 2979 CG13492-PD 2382..2540 22..183 174 31.5 Plus
CG13492-PD 2979 CG13492-PD 278..432 22..178 169 33.9 Plus
CG15773-PB 319 CG15773-PB 25..177 14..178 163 29.2 Plus
CG15773-PA 478 CG15773-PA 25..177 14..178 163 29.2 Plus
CG13492-PD 2979 CG13492-PD 2638..2790 22..180 162 29.9 Plus
CG13492-PD 2979 CG13492-PD 1120..1271 22..178 154 26.9 Plus
CG34040-PA 281 CG34040-PA 9..173 5..173 151 25.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15766-PA 214 GI15766-PA 1..206 1..206 681 60.7 Plus
Dmoj\GI20859-PA 2960 GI20859-PA 2781..2956 22..206 158 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20247-PA 217 GL20247-PA 1..217 1..214 820 71 Plus
Dper\GL17513-PA 2988 GL17513-PA 2807..2988 20..213 173 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13659-PA 217 GA13659-PA 1..217 1..214 825 71.9 Plus
Dpse\GA12325-PA 2988 GA12325-PA 2807..2988 20..213 173 30.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21334-PA 214 GM21334-PA 1..214 1..214 1033 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16112-PA 214 GD16112-PA 1..214 1..214 1048 93.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18623-PA 214 GJ18623-PA 1..206 1..206 752 66.5 Plus
Dvir\GJ20594-PA 2976 GJ20594-PA 2794..2976 18..214 172 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19986-PA 214 GK19986-PA 1..214 1..214 757 65.4 Plus
Dwil\GK15649-PA 2984 GK15649-PA 2801..2978 20..209 166 30.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17452-PA 214 GE17452-PA 1..214 1..214 1023 90.2 Plus
Dyak\GE13674-PA 2979 GE13674-PA 2799..2949 22..180 149 30.6 Plus

RH03540.hyp Sequence

Translation from 72 to 716

> RH03540.hyp
MKFYLLVIAALSFLAYISCDGCIQCNSKDNERCATDPLSLLNRNCSDGSS
NCYSRVLDGYTIRGCAVDLDNATRNSCNNELLCQLCTYSEGCNRNTFPLS
RLMCLQCTGNSTSSSCATETYVSAKICPLYKFGDKCYIRNSNRTVDGSFQ
RGCLTSANARKQCVKDGNCYTCEGRGCNFLLANDTNIPLARDSGAQLIIS
MTLLISGLVAAWRL*

RH03540.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-PA 214 CG15347-PA 1..214 1..214 1158 100 Plus
CG15347-PB 229 CG15347-PB 1..229 1..214 1132 93.4 Plus
CG13492-PD 2979 CG13492-PD 2799..2975 22..211 204 26.9 Plus
CG13492-PD 2979 CG13492-PD 1538..1695 22..178 184 31.7 Plus
CG13492-PD 2979 CG13492-PD 698..849 22..178 176 31.1 Plus
CG13492-PD 2979 CG13492-PD 1963..2114 22..178 176 32.7 Plus
CG13492-PD 2979 CG13492-PD 2382..2540 22..183 174 31.5 Plus
CG13492-PD 2979 CG13492-PD 278..432 22..178 169 33.9 Plus
CG15773-PB 319 CG15773-PB 25..177 14..178 163 29.2 Plus
CG15773-PA 478 CG15773-PA 25..177 14..178 163 29.2 Plus
CG13492-PD 2979 CG13492-PD 2638..2790 22..180 162 29.9 Plus
CG13492-PD 2979 CG13492-PD 1120..1271 22..178 154 26.9 Plus