Clone RH03850 Report

Search the DGRC for RH03850

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:38
Well:50
Vector:pFlc-1
Associated Gene/TranscriptObp56e-RA
Protein status:RH03850.pep: gold
Preliminary Size:513
Sequenced Size:546

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8462 2001-12-13 Blastp of sequenced clone
CG8462 2002-01-01 Sim4 clustering to Release 2
CG8462 2003-01-01 Sim4 clustering to Release 3
Obp56e 2008-04-29 Release 5.5 accounting
Obp56e 2008-08-15 Release 5.9 accounting
Obp56e 2008-12-18 5.12 accounting

Clone Sequence Records

RH03850.complete Sequence

546 bp (546 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070654

> RH03850.complete
GTACAGTTTCTATTCTAAAAGATTCTACACAGCAGATTACGATCAGCATC
ATGAAAGTATTCTTTGTGTTTGCCGCCCTTGCAGCTCTATCTTTGGCATC
TGCCGTGGGGCTAACTGATTCCCAAAAGGCTGAGGCAAAGCAGAGAGCCA
AGGCCTGCGTCAAACAGGAGGGAATCACGAAGGAGCAAGCTATTGCCCTG
CGGTCTGGAAACTTTGCAGACTCCGATCCAAAGGTAAAGTGCTTCGCCAA
CTGCTTCCTGGAGCAGACCGGCCTGGTGGCCAATGGGCAGATAAAACCTG
ACGTGGTTTTGGCCAAACTAGGTCCCATCGCCGGCGAAGCCAATGTCAAG
GAGGTGCAGGCCAAGTGTGACTCGACCAAGGGAGCCGACAAGTGCGACAC
TAGCTATCTGCTGTACAAGTGCTACTACGAAAACCACGCCCAATTCTAAG
AAAACCTTTTTTGATTTTCAAAAGAATATTTGTTTCTTTGATTACCAGTT
ATTCTCAATAAAAATTAGATCAGGCTTCCCAAAAAAAAAAAAAAAA

RH03850.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RA 734 Obp56e-RA 125..655 3..533 2655 100 Plus
nc_8077.a 1204 nc_8077.a 2..529 3..533 2585 99.4 Plus
Obp56d-RA 811 Obp56d-RA 489..582 357..450 200 80.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15599715..15600138 107..530 2075 99.3 Plus
chr2R 21145070 chr2R 15599555..15599660 3..108 515 99.1 Plus
chr2R 21145070 chr2R 15590492..15590777 450..165 245 72.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19712509..19712935 107..533 2135 100 Plus
2R 25286936 2R 19712349..19712454 3..108 530 100 Plus
2R 25286936 2R 19703284..19703569 450..165 260 72.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19713708..19714134 107..533 2135 100 Plus
2R 25260384 2R 19713548..19713653 3..108 530 100 Plus
2R 25260384 2R 19704483..19704576 450..357 200 80.8 Minus
Blast to na_te.dros performed 2019-03-16 14:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
jockey2 3428 jockey2 JOCKEY2 3428bp 824..864 466..426 106 73.2 Minus

RH03850.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:18:40 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15599553..15599659 1..107 97 -> Plus
chr2R 15599716..15600138 108..530 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:54 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 1..399 51..449 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:16 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 1..399 51..449 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:42:10 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 1..399 51..449 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:53 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 1..399 51..449 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:25:57 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 1..399 51..449 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:57 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 3..532 1..530 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:16 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 3..532 1..530 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:42:10 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 3..532 1..530 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:53 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 3..532 1..530 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:25:57 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 3..532 1..530 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:40 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19712510..19712932 108..530 100   Plus
2R 19712347..19712453 1..107 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:40 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19712510..19712932 108..530 100   Plus
2R 19712347..19712453 1..107 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:40 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19712510..19712932 108..530 100   Plus
2R 19712347..19712453 1..107 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:42:10 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15599852..15599958 1..107 98 -> Plus
arm_2R 15600015..15600437 108..530 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:58 Download gff for RH03850.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19713709..19714131 108..530 100   Plus
2R 19713546..19713652 1..107 98 -> Plus

RH03850.hyp Sequence

Translation from 2 to 448

> RH03850.hyp
TVSILKDSTQQITISIMKVFFVFAALAALSLASAVGLTDSQKAEAKQRAK
ACVKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQIKPD
VVLAKLGPIAGEANVKEVQAKCDSTKGADKCDTSYLLYKCYYENHAQF*

RH03850.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-PA 132 CG8462-PA 1..132 17..148 675 100 Plus
Obp56e-PB 131 CG8462-PB 1..131 17..148 659 99.2 Plus
Obp56d-PB 131 CG11218-PB 1..129 17..146 439 63.8 Plus
Obp56d-PA 131 CG11218-PA 1..129 17..146 439 63.8 Plus
Obp56a-PA 139 CG11797-PA 1..128 17..141 245 37.5 Plus

RH03850.pep Sequence

Translation from 50 to 448

> RH03850.pep
MKVFFVFAALAALSLASAVGLTDSQKAEAKQRAKACVKQEGITKEQAIAL
RSGNFADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVK
EVQAKCDSTKGADKCDTSYLLYKCYYENHAQF*

RH03850.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11735-PA 130 GF11735-PA 1..130 1..132 514 75.8 Plus
Dana\GF13167-PA 131 GF13167-PA 1..129 1..130 436 64.6 Plus
Dana\GF11734-PA 136 GF11734-PA 11..130 8..127 256 41.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21996-PA 132 GG21996-PA 1..132 1..132 530 84.8 Plus
Dere\GG20889-PA 131 GG20889-PA 1..131 1..132 421 59.8 Plus
Dere\GG21994-PA 139 GG21994-PA 1..128 1..125 238 38.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22760-PA 132 GH22760-PA 1..130 1..130 390 59.2 Plus
Dgri\GH23017-PA 132 GH23017-PA 3..128 4..129 275 40.5 Plus
Dgri\GH23015-PA 138 GH23015-PA 6..128 3..125 243 38.2 Plus
Dgri\GH23016-PA 135 GH23016-PA 1..126 1..125 204 31.7 Plus
Dgri\GH15401-PA 110 GH15401-PA 5..100 36..132 132 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-PA 132 CG8462-PA 1..132 1..132 675 100 Plus
Obp56e-PB 131 CG8462-PB 1..131 1..132 659 99.2 Plus
Obp56d-PB 131 CG11218-PB 1..129 1..130 439 63.8 Plus
Obp56d-PA 131 CG11218-PA 1..129 1..130 439 63.8 Plus
Obp56a-PA 139 CG11797-PA 1..128 1..125 245 37.5 Plus
Obp56f-PA 125 CG30450-PA 1..119 1..125 135 29 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18537-PA 132 GI18537-PA 1..132 1..132 411 59.8 Plus
Dmoj\GI21083-PA 130 GI21083-PA 1..128 1..130 344 51.5 Plus
Dmoj\GI21082-PA 138 GI21082-PA 1..128 1..125 248 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11722-PA 131 GL11722-PA 1..131 1..132 462 64.4 Plus
Dper\GL10359-PA 130 GL10359-PA 1..130 1..132 460 70.5 Plus
Dper\GL10358-PA 137 GL10358-PA 1..134 1..131 251 38.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp56e-PA 130 GA21096-PA 1..130 1..132 464 71.2 Plus
Dpse\Obp56d-PA 131 GA10849-PA 1..131 1..132 462 64.4 Plus
Dpse\Obp56a-PA 137 GA11204-PA 1..134 1..131 250 38.8 Plus
Dpse\Obp69a-PA 149 GA10317-PA 13..139 6..132 154 26 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Obp56e-PA 119 GM23181-PA 1..119 1..132 495 84.1 Plus
Dsec\GM23170-PA 131 GM23170-PA 1..131 1..132 443 63.6 Plus
Dsec\GM21981-PA 139 GM21981-PA 1..128 1..125 237 37.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp56e-PA 132 GD11478-PA 1..132 1..132 597 94.7 Plus
Dsim\Obp56d-PA 131 GD15213-PA 1..131 1..132 446 64.4 Plus
Dsim\Obp56a-PA 139 GD11477-PA 1..128 1..125 242 38.3 Plus
Dsim\Obp56f-PA 125 GD11479-PA 1..119 1..125 141 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp56d-PA 132 GJ21407-PA 1..132 1..132 399 62.9 Plus
Dvir\Obp56eL1-PA 130 GJ20932-PA 3..128 5..130 339 48.4 Plus
Dvir\Obp56a-PA 138 GJ20931-PA 1..128 1..125 245 37.5 Plus
Dvir\Obp69a-PA 147 GJ13150-PA 17..137 11..132 133 23.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15691-PA 132 GK15691-PA 1..132 1..132 471 66.7 Plus
Dwil\GK15692-PA 132 GK15692-PA 1..132 1..132 438 67.4 Plus
Dwil\GK15889-PA 139 GK15889-PA 1..130 1..127 263 42.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Obp56e-PA 132 GE12075-PA 1..132 1..132 578 84.8 Plus
Dyak\GE13830-PA 131 GE13830-PA 1..131 1..132 437 62.1 Plus
Dyak\GE12074-PA 139 GE12074-PA 1..128 1..125 248 39.1 Plus