Clone RH03863 Report

Search the DGRC for RH03863

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:38
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG17574-RA
Protein status:RH03863.pep: gold
Preliminary Size:1911
Sequenced Size:1173

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17574 2001-12-13 Blastp of sequenced clone
CG17574 2002-01-01 Sim4 clustering to Release 2
CG17574 2003-01-01 Sim4 clustering to Release 3
CG17574 2008-04-29 Release 5.5 accounting
CG17574 2008-08-15 Release 5.9 accounting
CG17574 2008-12-18 5.12 accounting

Clone Sequence Records

RH03863.complete Sequence

1173 bp (1173 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070655

> RH03863.complete
GGTCAGTGCTGCATAACGTGCACCCATTATCATCATGATAAATTGTATTA
CTTTCAGATTAACGCTGATAAGATATAGTTAATTCCAATCGGGCTTCAAT
AACGACCTTCCGGTAGAGTAGTTCACTGATATTTAAGTGAATTATACGGG
TGCTGCCAAAAAGCGGATAAATCCGATAAATAGGCAGTGCATTCCCTGCA
ACAAGTGGAATTTTCGACTTTAAATACAGATATTAACAAAGGGAAATAAC
CGCTAAATCCTTGTCAAACTGGACGACTTTGAGTTGGACGATATAGACGA
TTTCGCCATGGATTTCTGGGGCATTTTCATGTTCTTTCTGCTCACCTTCC
TCATCATGAGTTGCTGCGGATATTGCTGCACCAGCAGACGCCAAGGTGCC
GTTCTGTCCACGCCTGTGGTGGTGACCTCCGCCACCCACACGGCTCCCGG
CGGATATCCGGTCACACAGCTGCCTCCGCCGGGCTATCCATCGAGCAATG
CCTACGTAACTGCGACCTCGTACCCCGTACAGACCACCGGCAACGTGACT
GTGCAGATGCCCATGCCGATGAGCCACCAGAACCAGCAGCAAATGCCAAT
GCCTATGCCGATGCCGGGTCAGCAAACGCATGGCGTGGCGTATCCGACGT
ATCCTGGCGCCGGGGCTGCCAACATGAATCCGCCGCCGTATGACATGTCC
ATGGCTAATCCAGGACCTAGTGTTATGCCCGCTGGATATGAGAAGCAAGC
TCCCTACAATCCCCACTTTGGCCAGTGAAATCGCACTGTGAACTGAGGAT
CCCCTTTCCGTCTCGTTATAGCTTTTTTACTCAGCTGAACACTTTACTTT
CCATGTTTTCTTGCATAAAAAACTCCAAACTCCTGGTAAAAAACCAAGTG
AAAGCGATCGCACAACGAGCCATTTTTATATTCCATGTGATGTATGTAAA
GTGTACATATAACTTAAGCGCAACCTTCTATTTATACATCTATATTAAGC
AAATCCAAAACGAAAACCAAACTGAACTACATGAAGTGTTAATTGTAATA
AACCAGTGAAGTGCACATCAAATGCAACTGAAGCACATTTGTTTCGATGT
GCACTTTCACAAAATCACAAAAACAAGAAATGCAAACATGTTTTCAATTA
CTTCTGCAAAAAAAAAAAAAAAA

RH03863.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG17574-RA 1506 CG17574-RA 328..1484 2..1158 5785 100 Plus
CG17574.b 1028 CG17574.b 279..1027 410..1158 3745 100 Plus
CG17574.c 816 CG17574.c 70..816 411..1157 3735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8736658..8737197 1157..618 2700 100 Minus
chr2R 21145070 chr2R 8756451..8756718 269..2 1340 100 Minus
chr2R 21145070 chr2R 8756244..8756384 410..270 705 100 Minus
chr2R 21145070 chr2R 8737399..8737528 540..411 650 100 Minus
chr2R 21145070 chr2R 8737261..8737339 618..540 395 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12849357..12849897 1158..618 2705 100 Minus
2R 25286936 2R 12869150..12869417 269..2 1340 100 Minus
2R 25286936 2R 12868943..12869083 410..270 705 100 Minus
2R 25286936 2R 12850099..12850228 540..411 650 100 Minus
2R 25286936 2R 12849961..12850039 618..540 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12850556..12851096 1158..618 2705 100 Minus
2R 25260384 2R 12870349..12870616 269..2 1340 100 Minus
2R 25260384 2R 12870142..12870282 410..270 705 100 Minus
2R 25260384 2R 12851298..12851427 540..411 650 100 Minus
2R 25260384 2R 12851160..12851238 618..540 395 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:41:57 has no hits.

RH03863.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:42:45 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8736658..8737196 619..1157 100 <- Minus
chr2R 8737261..8737338 541..618 100 <- Minus
chr2R 8737399..8737528 411..540 100 <- Minus
chr2R 8756244..8756384 270..410 100 <- Minus
chr2R 8756451..8756718 1..269 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:38:38 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 1..471 308..778 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:05 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 1..471 308..778 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:22:52 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 1..471 308..778 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:11 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 1..471 308..778 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:56:02 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 1..471 308..778 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:38:37 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 6..1162 1..1157 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:05 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 6..1162 1..1157 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:22:52 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 6..1162 1..1157 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:11 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 6..1162 1..1157 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:56:02 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
CG17574-RA 6..1162 1..1157 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:45 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12849358..12849896 619..1157 100 <- Minus
2R 12849961..12850038 541..618 100 <- Minus
2R 12850099..12850228 411..540 100 <- Minus
2R 12868943..12869083 270..410 100 <- Minus
2R 12869150..12869417 1..269 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:45 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12849358..12849896 619..1157 100 <- Minus
2R 12849961..12850038 541..618 100 <- Minus
2R 12850099..12850228 411..540 100 <- Minus
2R 12868943..12869083 270..410 100 <- Minus
2R 12869150..12869417 1..269 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:45 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12849358..12849896 619..1157 100 <- Minus
2R 12849961..12850038 541..618 100 <- Minus
2R 12850099..12850228 411..540 100 <- Minus
2R 12868943..12869083 270..410 100 <- Minus
2R 12869150..12869417 1..269 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:22:52 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8756655..8756922 1..269 99   Minus
arm_2R 8736863..8737401 619..1157 100 <- Minus
arm_2R 8737466..8737543 541..618 100 <- Minus
arm_2R 8737604..8737733 411..540 100 <- Minus
arm_2R 8756448..8756588 270..410 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:13 Download gff for RH03863.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12850557..12851095 619..1157 100 <- Minus
2R 12851160..12851237 541..618 100 <- Minus
2R 12851298..12851427 411..540 100 <- Minus
2R 12870142..12870282 270..410 100 <- Minus
2R 12870349..12870616 1..269 99   Minus

RH03863.pep Sequence

Translation from 307 to 777

> RH03863.pep
MDFWGIFMFFLLTFLIMSCCGYCCTSRRQGAVLSTPVVVTSATHTAPGGY
PVTQLPPPGYPSSNAYVTATSYPVQTTGNVTVQMPMPMSHQNQQQMPMPM
PMPGQQTHGVAYPTYPGAGAANMNPPPYDMSMANPGPSVMPAGYEKQAPY
NPHFGQ*

RH03863.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12001-PA 156 GF12001-PA 1..156 1..156 580 78.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22545-PA 152 GG22545-PA 1..152 1..156 684 85.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20128-PA 153 GH20128-PA 1..153 1..156 445 65 Plus
Dgri\GH23912-PA 149 GH23912-PA 2..149 3..156 294 49.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17574-PA 156 CG17574-PA 1..156 1..156 871 100 Plus
CG17574-PJ 157 CG17574-PJ 1..157 1..156 859 99.4 Plus
CG17574-PI 175 CG17574-PI 31..175 6..156 699 86.1 Plus
CG17574-PF 162 CG17574-PF 7..162 3..156 688 82.2 Plus
CG17574-PE 174 CG17574-PE 24..174 11..156 686 84.1 Plus
CG17574-PL 157 CG17574-PL 14..157 10..156 685 85 Plus
CG17574-PG 164 CG17574-PG 14..164 8..156 684 81.6 Plus
CG17574-PH 174 CG17574-PH 52..174 34..156 680 99.2 Plus
CG17574-PK 153 CG17574-PK 29..153 32..156 678 97.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20218-PA 153 GI20218-PA 1..153 1..156 443 68.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17453-PA 151 GL17453-PA 1..151 1..156 577 80.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14562-PA 149 GA14562-PA 1..149 1..156 567 81.4 Plus
Dpse\GA14562-PB 155 GA14562-PB 7..155 3..156 411 65 Plus
Dpse\GA14562-PC 167 GA14562-PC 19..167 2..156 409 64.1 Plus
Dpse\GA14562-PD 155 GA14562-PD 2..155 1..156 396 62 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20330-PA 201 GM20330-PA 1..201 1..156 622 73.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25807-PA 201 GD25807-PA 1..201 1..156 627 74.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20168-PA 150 GJ20168-PA 1..150 1..156 509 69.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20881-PA 142 GK20881-PA 1..142 1..156 449 67.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13415-PA 154 GE13415-PA 1..154 1..156 611 90.4 Plus

RH03863.hyp Sequence

Translation from 307 to 777

> RH03863.hyp
MDFWGIFMFFLLTFLIMSCCGYCCTSRRQGAVLSTPVVVTSATHTAPGGY
PVTQLPPPGYPSSNAYVTATSYPVQTTGNVTVQMPMPMSHQNQQQMPMPM
PMPGQQTHGVAYPTYPGAGAANMNPPPYDMSMANPGPSVMPAGYEKQAPY
NPHFGQ*

RH03863.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17574-PA 156 CG17574-PA 1..156 1..156 871 100 Plus
CG17574-PJ 157 CG17574-PJ 1..157 1..156 859 99.4 Plus
CG17574-PI 175 CG17574-PI 31..175 6..156 699 86.1 Plus
CG17574-PF 162 CG17574-PF 7..162 3..156 688 82.2 Plus
CG17574-PL 157 CG17574-PL 14..157 10..156 685 85 Plus