Clone RH03891 Report

Search the DGRC for RH03891

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:38
Well:91
Vector:pFlc-1
Associated Gene/TranscriptCG7409-RA
Protein status:RH03891.pep: gold
Preliminary Size:606
Sequenced Size:799

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7409 2002-01-01 Sim4 clustering to Release 2
CG7409 2003-01-01 Sim4 clustering to Release 3
CG7409 2005-05-04 Blastp of sequenced clone
CG7409 2008-04-29 Release 5.5 accounting
CG7409 2008-08-15 Release 5.9 accounting
CG7409 2008-12-18 5.12 accounting

Clone Sequence Records

RH03891.complete Sequence

799 bp (799 high quality bases) assembled on 2005-05-04

GenBank Submission: BT022082

> RH03891.complete
GTTTAATTTGCTCAGAGCAGAAAACGCGAGTGGACGTCTATCAGAAAGCG
CGATAAGTGGAAAGTAAATACAAACTAGCGTTGCTGTTGGTCCTGTCCTA
AGGAATAATAACTACCACAAAATGGCTCTTGTCCCGGCTACAAACAATAC
GGATTGGGATTACTGGGATTACCGTCGTCGGCTGTGGCGCGATTGGGATT
TGAACGACTGGGACTTGCCCTACTGGAAGCGATCACTATCTCGCGTTGGA
TCCGCACCCGATCTAAGTCGGGTAATTGTCGGAAAGGATGGTTTCGAGGC
CAATGTGGATGTGCACCTGTTCAAGCCCTATGAGATTAGCGTGAAGACCT
CAGGCGACACTGTGGTCGTGGAGGCCAAGCACGAGAAGCGACGTGATGGT
GACACCTTCGTGGGTCGCCACATCGTCAAGCGGTTCGTCCTGCCCCGAGG
ATACTATCCCAACGATGTGCGATCGGAACTGTCGTCCGATGGCATACTTA
CCGTCAAGTGTCCGCCGTATTTGACCAACGAGCGGAGTGTGTACGTCCGC
CAAGTGGGTCCTTCGTATCTAAGCATCAAGAACTAATCACAGTCTATAGC
ATCGTAACTCCGTGTTTTGTTCTTAGTTACTTTCTGTTGGAGCTAAAATT
AAGACAAAAGTAATGCACATATTTCTAAGACTAGAATTGGACTCTTTTTG
TTATTAACAAAGCAACGTTTGTTTAGTTAAATAAAATAAAAGTTTAATTT
ATTAATAATGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RH03891.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7409-RA 766 CG7409-RA 1..762 1..762 3810 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7746503..7747262 1..760 3710 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7754409..7755170 1..762 3810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7747509..7748270 1..762 3810 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:43:00 has no hits.

RH03891.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:43:59 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7746503..7747224 1..722 99 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:56 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..465 122..586 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:27 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..465 122..586 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:20 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..465 122..586 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:16:06 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..465 122..586 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:40 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..465 122..586 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:13:14 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..760 1..760 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:27 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..760 1..760 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:20 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..760 1..760 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:16:06 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..760 1..760 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:40 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
CG7409-RA 1..760 1..760 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:59 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7754409..7755168 1..760 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:59 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7754409..7755168 1..760 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:59 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7754409..7755168 1..760 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:20 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7747509..7748268 1..760 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:56 Download gff for RH03891.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7747509..7748268 1..760 100   Plus

RH03891.pep Sequence

Translation from 121 to 585

> RH03891.pep
MALVPATNNTDWDYWDYRRRLWRDWDLNDWDLPYWKRSLSRVGSAPDLSR
VIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRH
IVKRFVLPRGYYPNDVRSELSSDGILTVKCPPYLTNERSVYVRQVGPSYL
SIKN*

RH03891.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10323-PA 155 GF10323-PA 1..155 1..154 772 96.1 Plus
Dana\GF10691-PA 190 GF10691-PA 42..172 32..154 260 42.7 Plus
Dana\GF23739-PA 205 GF23739-PA 81..186 53..153 248 46.2 Plus
Dana\GF10692-PA 219 GF10692-PA 90..195 53..153 235 48.1 Plus
Dana\GF11829-PA 187 GF11829-PA 57..173 33..148 212 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14448-PA 154 GG14448-PA 1..154 1..154 800 99.4 Plus
Dere\GG15370-PA 187 GG15370-PA 67..172 53..153 264 49.1 Plus
Dere\GG15371-PA 212 GG15371-PA 86..191 53..153 252 50.9 Plus
Dere\GG14047-PA 208 GG14047-PA 84..189 53..153 243 45.3 Plus
Dere\GG14046-PA 445 GG14046-PA 120..221 52..145 231 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15298-PA 155 GH15298-PA 1..155 1..154 727 91.7 Plus
Dgri\GH17009-PA 218 GH17009-PA 55..194 18..153 273 40.4 Plus
Dgri\GH23707-PA 185 GH23707-PA 46..173 29..154 266 42.7 Plus
Dgri\GH16863-PA 185 GH16863-PA 46..173 29..154 266 42.7 Plus
Dgri\GH17008-PA 180 GH17008-PA 62..168 53..154 261 47.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG7409-PA 154 CG7409-PA 1..154 1..154 838 100 Plus
Hsp27-PB 213 CG4466-PB 73..190 41..153 281 46.6 Plus
Hsp27-PA 213 CG4466-PA 73..190 41..153 281 46.6 Plus
Hsp23-PB 186 CG4463-PB 58..171 43..153 252 46.6 Plus
Hsp23-PA 186 CG4463-PA 58..171 43..153 252 46.6 Plus
Hsp26-PB 208 CG4183-PB 84..189 53..153 240 45.3 Plus
Hsp26-PA 208 CG4183-PA 84..189 53..153 240 45.3 Plus
CG4461-PA 200 CG4461-PA 90..193 50..146 225 45.2 Plus
Hsp67Ba-PA 445 CG4167-PA 121..213 52..144 223 43 Plus
l(2)efl-PC 187 CG4533-PC 43..173 15..148 200 37 Plus
l(2)efl-PA 187 CG4533-PA 43..173 15..148 200 37 Plus
Hsp67Bc-PA 199 CG4190-PA 81..177 58..150 196 41.2 Plus
Hsp22-PB 174 CG4460-PB 59..157 53..146 146 38.6 Plus
Hsp22-PA 174 CG4460-PA 59..157 53..146 146 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12009-PA 155 GI12009-PA 1..155 1..154 732 92.3 Plus
Dmoj\GI13087-PA 209 GI13087-PA 48..187 14..153 272 41.7 Plus
Dmoj\GI13085-PA 185 GI13085-PA 55..170 41..153 261 45.8 Plus
Dmoj\GI12247-PA 211 GI12247-PA 88..193 53..153 248 47.2 Plus
Dmoj\GI12245-PA 198 GI12245-PA 87..191 49..146 231 45.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18037-PA 163 GL18037-PA 13..163 4..154 762 94.7 Plus
Dper\GL22446-PA 184 GL22446-PA 66..172 53..154 266 50.5 Plus
Dper\GL22443-PA 184 GL22443-PA 66..172 53..154 266 50.5 Plus
Dper\GL22632-PA 204 GL22632-PA 80..186 53..154 255 44.9 Plus
Dper\GL22447-PA 225 GL22447-PA 93..198 53..153 235 48.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20330-PA 154 GA20330-PA 1..154 1..154 778 94.8 Plus
Dpse\GA18202-PA 184 GA18202-PA 66..172 53..154 263 50.5 Plus
Dpse\GA18011-PA 204 GA18011-PA 80..186 53..154 255 44.9 Plus
Dpse\GA18205-PA 225 GA18205-PA 93..198 53..153 235 48.1 Plus
Dpse\GA28726-PA 144 GA28726-PA 12..117 53..153 234 48.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25000-PA 154 GM25000-PA 1..154 1..154 802 100 Plus
Dsec\GM25142-PA 183 GM25142-PA 42..168 32..153 260 42.5 Plus
Dsec\GM25143-PA 213 GM25143-PA 73..190 41..153 257 47.5 Plus
Dsec\GM24881-PA 211 GM24881-PA 84..190 53..154 247 45.8 Plus
Dsec\GM24880-PA 403 GM24880-PA 93..222 24..145 229 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14033-PA 154 GD14033-PA 1..154 1..154 802 100 Plus
Dsim\GD14177-PA 213 GD14177-PA 85..190 53..153 253 50.9 Plus
Dsim\GD12933-PA 211 GD12933-PA 84..190 53..154 247 45.8 Plus
Dsim\GD12932-PA 391 GD12932-PA 39..168 24..145 229 35.4 Plus
Dsim\GD14176-PA 177 GD14176-PA 66..162 53..153 226 45.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13280-PA 155 GJ13280-PA 1..155 1..154 740 93.6 Plus
Dvir\GJ13835-PA 211 GJ13835-PA 48..189 14..153 273 42.8 Plus
Dvir\GJ13834-PA 186 GJ13834-PA 66..171 53..153 266 48.1 Plus
Dvir\GJ11479-PA 216 GJ11479-PA 87..192 53..153 251 46.2 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 86..191 53..153 246 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21206-PA 155 GK21206-PA 1..155 1..154 759 94.2 Plus
Dwil\GK17636-PA 186 GK17636-PA 54..170 42..153 264 46.2 Plus
Dwil\GK17637-PA 227 GK17637-PA 93..198 53..153 250 50.9 Plus
Dwil\GK16566-PA 216 GK16566-PA 88..195 53..154 232 46.3 Plus
Dwil\GK23172-PA 187 GK23172-PA 57..173 33..148 214 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21638-PA 154 GE21638-PA 1..154 1..154 800 99.4 Plus
Dyak\GE20832-PA 186 GE20832-PA 66..171 53..153 265 49.1 Plus
Dyak\GE20833-PA 212 GE20833-PA 86..191 53..153 250 50.9 Plus
Dyak\GE21250-PA 208 GE21250-PA 84..189 53..153 248 47.2 Plus
Dyak\GE11545-PA 187 GE11545-PA 57..173 33..148 211 40 Plus

RH03891.hyp Sequence

Translation from 121 to 585

> RH03891.hyp
MALVPATNNTDWDYWDYRRRLWRDWDLNDWDLPYWKRSLSRVGSAPDLSR
VIVGKDGFEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRH
IVKRFVLPRGYYPNDVRSELSSDGILTVKCPPYLTNERSVYVRQVGPSYL
SIKN*

RH03891.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG7409-PA 154 CG7409-PA 1..154 1..154 838 100 Plus
Hsp27-PB 213 CG4466-PB 73..190 41..153 281 46.6 Plus
Hsp27-PA 213 CG4466-PA 73..190 41..153 281 46.6 Plus
Hsp23-PB 186 CG4463-PB 58..171 43..153 252 46.6 Plus
Hsp23-PA 186 CG4463-PA 58..171 43..153 252 46.6 Plus