BDGP Sequence Production Resources |
Search the DGRC for RH03940
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 39 |
Well: | 40 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL32-RA |
Protein status: | RH03940.pep: gold |
Preliminary Size: | 505 |
Sequenced Size: | 506 |
Gene | Date | Evidence |
---|---|---|
CG7939 | 2001-12-13 | Blastp of sequenced clone |
CG7939 | 2002-01-01 | Sim4 clustering to Release 2 |
RpL32 | 2008-04-29 | Release 5.5 accounting |
RpL32 | 2008-08-15 | Release 5.9 accounting |
RpL32 | 2008-12-18 | 5.12 accounting |
506 bp (506 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070656
> RH03940.complete GCTTTTTTCGCTTCTGGTTTCCGGCAAGCTTCAAGATGACCATCCGCCCA GCATACAGGCCCAAGATCGTGAAGAAGCGCACCAAGCACTTCATCCGCCA CCAGTCGGATCGATATGCTAAGCTGTCGCACAAATGGCGCAAGCCCAAGG GTATCGACAACAGAGTGCGTCGCCGCTTCAAGGGACAGTATCTGATGCCC AACATCGGTTACGGATCGAACAAGCGCACCCGCCACATGCTGCCCACCGG ATTCAAGAAGTTCCTGGTGCACAACGTGCGCGAGCTGGAGGTCCTGCTCA TGCAGAACCGCGTTTACTGCGGCGAGATCGCCCACGGCGTCTCCTCCAAG AAGCGCAAGGAGATTGTCGAGCGCGCCAAGCAGCTGTCGGTCCGCCTCAC CAACCCCAACGGTCGCCTGCGTTCTCAAGAGAACGAGTAAGCTTAAGATT CTTGAGAGTTCTTGTAACGTGGTCGGAATACACATTTGTAAACGTTAAAA AAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25867672..25868039 | 129..496 | 100 | <- | Minus |
chr3R | 25868102..25868201 | 29..128 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RC | 25..444 | 21..440 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RC | 25..444 | 21..440 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RC | 25..444 | 21..440 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RC | 25..444 | 21..440 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RC | 25..444 | 21..440 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RB | 2..493 | 5..496 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RB | 2..493 | 5..496 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RB | 2..496 | 3..496 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RB | 2..493 | 5..496 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL32-RB | 2..496 | 3..496 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30045257..30045624 | 129..496 | 100 | <- | Minus |
3R | 30045687..30045786 | 29..128 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30045257..30045624 | 129..496 | 100 | <- | Minus |
3R | 30045687..30045786 | 29..128 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30045257..30045624 | 129..496 | 100 | <- | Minus |
3R | 30045687..30045786 | 29..128 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25870979..25871346 | 129..496 | 100 | <- | Minus |
arm_3R | 25871409..25871508 | 29..128 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29786088..29786455 | 129..496 | 100 | <- | Minus |
3R | 29786518..29786617 | 29..128 | 100 | <- | Minus |
Translation from 29 to 439
> RH03940.hyp FKMTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKPKGIDNRVRRRF KGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEI AHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL32-PC | 147 | CG7939-PC | 12..147 | 1..136 | 716 | 100 | Plus |
RpL32-PD | 134 | CG7939-PD | 1..134 | 3..136 | 705 | 100 | Plus |
RpL32-PA | 134 | CG7939-PA | 1..134 | 3..136 | 705 | 100 | Plus |
RpL32-PB | 134 | CG7939-PB | 1..134 | 3..136 | 705 | 100 | Plus |
Translation from 35 to 439
> RH03940.pep MTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKPKGIDNRVRRRFKG QYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEIAH GVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23239-PA | 134 | GF23239-PA | 1..134 | 1..134 | 700 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11969-PA | 134 | GG11969-PA | 1..134 | 1..134 | 704 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18400-PA | 134 | GH18400-PA | 1..134 | 1..134 | 698 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL32-PD | 134 | CG7939-PD | 1..134 | 1..134 | 705 | 100 | Plus |
RpL32-PA | 134 | CG7939-PA | 1..134 | 1..134 | 705 | 100 | Plus |
RpL32-PB | 134 | CG7939-PB | 1..134 | 1..134 | 705 | 100 | Plus |
RpL32-PC | 147 | CG7939-PC | 14..147 | 1..134 | 705 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23390-PA | 134 | GI23390-PA | 1..134 | 1..134 | 704 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\RpL32-PA | 134 | GL13481-PA | 1..134 | 1..134 | 696 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\RpL32-PB | 134 | GA20704-PB | 1..134 | 1..134 | 698 | 97.8 | Plus |
Dpse\RpL32-PA | 134 | GA20704-PA | 1..134 | 1..134 | 698 | 97.8 | Plus |
Dpse\GA27885-PA | 87 | GA27885-PA | 1..87 | 1..134 | 376 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12186-PA | 134 | GM12186-PA | 1..134 | 1..134 | 704 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\RpL32-PA | 134 | GD17388-PA | 1..134 | 1..134 | 704 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\RpL32-PA | 134 | GJ10385-PA | 1..134 | 1..134 | 704 | 100 | Plus |
Dvir\GJ22904-PA | 124 | GJ22904-PA | 86..124 | 94..132 | 146 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\RpL32-PA | 134 | GK13422-PA | 1..134 | 1..134 | 690 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL32-PA | 134 | GE23418-PA | 1..134 | 1..134 | 704 | 100 | Plus |