Clone RH03940 Report

Search the DGRC for RH03940

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:39
Well:40
Vector:pFlc-1
Associated Gene/TranscriptRpL32-RA
Protein status:RH03940.pep: gold
Preliminary Size:505
Sequenced Size:506

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7939 2001-12-13 Blastp of sequenced clone
CG7939 2002-01-01 Sim4 clustering to Release 2
RpL32 2008-04-29 Release 5.5 accounting
RpL32 2008-08-15 Release 5.9 accounting
RpL32 2008-12-18 5.12 accounting

Clone Sequence Records

RH03940.complete Sequence

506 bp (506 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070656

> RH03940.complete
GCTTTTTTCGCTTCTGGTTTCCGGCAAGCTTCAAGATGACCATCCGCCCA
GCATACAGGCCCAAGATCGTGAAGAAGCGCACCAAGCACTTCATCCGCCA
CCAGTCGGATCGATATGCTAAGCTGTCGCACAAATGGCGCAAGCCCAAGG
GTATCGACAACAGAGTGCGTCGCCGCTTCAAGGGACAGTATCTGATGCCC
AACATCGGTTACGGATCGAACAAGCGCACCCGCCACATGCTGCCCACCGG
ATTCAAGAAGTTCCTGGTGCACAACGTGCGCGAGCTGGAGGTCCTGCTCA
TGCAGAACCGCGTTTACTGCGGCGAGATCGCCCACGGCGTCTCCTCCAAG
AAGCGCAAGGAGATTGTCGAGCGCGCCAAGCAGCTGTCGGTCCGCCTCAC
CAACCCCAACGGTCGCCTGCGTTCTCAAGAGAACGAGTAAGCTTAAGATT
CTTGAGAGTTCTTGTAACGTGGTCGGAATACACATTTGTAAACGTTAAAA
AAAAAA

RH03940.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32.b 977 RpL32.b 267..760 5..498 2470 100 Plus
RpL32-RB 1027 RpL32-RB 267..760 5..498 2470 100 Plus
RpL32.a 607 RpL32.a 1..498 5..498 2405 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25867672..25868040 496..128 1845 100 Minus
chr3R 27901430 chr3R 25868102..25868203 128..27 510 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30045255..30045625 498..128 1855 100 Minus
3R 32079331 3R 30045687..30045788 128..27 510 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29786086..29786456 498..128 1855 100 Minus
3R 31820162 3R 29786518..29786619 128..27 510 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:41:17 has no hits.

RH03940.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:42:27 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25867672..25868039 129..496 100 <- Minus
chr3R 25868102..25868201 29..128 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:38:58 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 25..444 21..440 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:15:53 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 25..444 21..440 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:07:35 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 25..444 21..440 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:41:59 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 25..444 21..440 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:04 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 25..444 21..440 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:47:54 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RB 2..493 5..496 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:15:53 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RB 2..493 5..496 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:35 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RB 2..496 3..496 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:00 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RB 2..493 5..496 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:04 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RB 2..496 3..496 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:27 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30045257..30045624 129..496 100 <- Minus
3R 30045687..30045786 29..128 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:27 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30045257..30045624 129..496 100 <- Minus
3R 30045687..30045786 29..128 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:27 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30045257..30045624 129..496 100 <- Minus
3R 30045687..30045786 29..128 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:35 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25870979..25871346 129..496 100 <- Minus
arm_3R 25871409..25871508 29..128 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:17:59 Download gff for RH03940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29786088..29786455 129..496 100 <- Minus
3R 29786518..29786617 29..128 100 <- Minus

RH03940.hyp Sequence

Translation from 29 to 439

> RH03940.hyp
FKMTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKPKGIDNRVRRRF
KGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEI
AHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE*

RH03940.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-PC 147 CG7939-PC 12..147 1..136 716 100 Plus
RpL32-PD 134 CG7939-PD 1..134 3..136 705 100 Plus
RpL32-PA 134 CG7939-PA 1..134 3..136 705 100 Plus
RpL32-PB 134 CG7939-PB 1..134 3..136 705 100 Plus

RH03940.pep Sequence

Translation from 35 to 439

> RH03940.pep
MTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKPKGIDNRVRRRFKG
QYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEIAH
GVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE*

RH03940.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23239-PA 134 GF23239-PA 1..134 1..134 700 98.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11969-PA 134 GG11969-PA 1..134 1..134 704 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18400-PA 134 GH18400-PA 1..134 1..134 698 97.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-PD 134 CG7939-PD 1..134 1..134 705 100 Plus
RpL32-PA 134 CG7939-PA 1..134 1..134 705 100 Plus
RpL32-PB 134 CG7939-PB 1..134 1..134 705 100 Plus
RpL32-PC 147 CG7939-PC 14..147 1..134 705 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23390-PA 134 GI23390-PA 1..134 1..134 704 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\RpL32-PA 134 GL13481-PA 1..134 1..134 696 97 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\RpL32-PB 134 GA20704-PB 1..134 1..134 698 97.8 Plus
Dpse\RpL32-PA 134 GA20704-PA 1..134 1..134 698 97.8 Plus
Dpse\GA27885-PA 87 GA27885-PA 1..87 1..134 376 61.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12186-PA 134 GM12186-PA 1..134 1..134 704 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\RpL32-PA 134 GD17388-PA 1..134 1..134 704 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\RpL32-PA 134 GJ10385-PA 1..134 1..134 704 100 Plus
Dvir\GJ22904-PA 124 GJ22904-PA 86..124 94..132 146 76.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\RpL32-PA 134 GK13422-PA 1..134 1..134 690 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL32-PA 134 GE23418-PA 1..134 1..134 704 100 Plus