BDGP Sequence Production Resources |
Search the DGRC for RH04252
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 42 |
Well: | 52 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Npc2h-RA |
Protein status: | RH04252.pep: gold |
Sequenced Size: | 609 |
Gene | Date | Evidence |
---|---|---|
CG11315 | 2001-12-17 | Blastp of sequenced clone |
CG11315 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11315 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11315 | 2008-04-29 | Release 5.5 accounting |
CG11315 | 2008-08-15 | Release 5.9 accounting |
CG11315 | 2008-12-18 | 5.12 accounting |
609 bp (609 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071674
> RH04252.complete GATTCCGCGTCCGACTTTCGATCCATCATGTTGCGTCTGAGTTCGCTCCT GCCTGTCGCCTTTGCTCTGGTGTTGTCATCCGTCTCCGCTGAGATAGTCA ACTTTCAGACTTGCGAAGATAGTGTGGACTCCTGCTCGATTAGTCAGGTG CGGGTGACGCCCTGTCCGGAAGCCAATGCCAATGCCGCATGCCACATTCG CCGGAGGCACCGCTTCACGATGAGCTTCGACTTTACGCCCCACTTCGATG CGGACACCCTGGTGGCCAGCTTGGGCTGGGCCAAGAGCGAGAACGTGGAG CTGCCCCTGCTTACCATGGACCAGGAGGCCTGCAAGTACACCACCTGCCC CGTGAGATCCGGAGTCACCCAGACCTACACCAACAACATGCCCGCCGACG CCAGGTTCCCGCTGAGTCCATACACCATCCGTTGGGCCCTGAAGGATCCG GTTTCCCAGAAACGTTGCTGCTTCACCATCGACATCAAGGTGGTGCGCTA GCAAGGTGCACTCCGTAATGGATGCTCCACTTAATATTTGGATTAATATA TATCTTAAATATCTTCGAAATTAAAGTGATTTACAAGTGGGTCGAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2h-RA | 810 | Npc2h-RA | 3..596 | 2..595 | 2970 | 100 | Plus |
Npc2h-RB | 729 | Npc2h-RB | 3..336 | 2..335 | 1670 | 100 | Plus |
Npc2h-RB | 729 | Npc2h-RB | 337..515 | 417..595 | 895 | 100 | Plus |
Npc2g-RA | 658 | Npc2g-RA | 226..506 | 219..499 | 865 | 87.1 | Plus |
Npc2g-RA | 658 | Npc2g-RA | 3..61 | 2..60 | 160 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 30486524..30487117 | 595..2 | 2970 | 100 | Minus |
3R | 31820162 | 3R | 30485587..30485867 | 499..219 | 865 | 87.1 | Minus |
3R | 31820162 | 3R | 30486032..30486090 | 60..2 | 160 | 84.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26568197..26568789 | 1..594 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11315-RA | 1..474 | 28..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2h-RA | 1..474 | 28..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2h-RA | 1..474 | 28..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11315-RA | 1..474 | 28..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2h-RA | 1..474 | 28..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11315-RA | 1..595 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2h-RA | 1..595 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2h-RA | 1..595 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11315-RA | 1..595 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Npc2h-RA | 3..597 | 1..594 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30745694..30746286 | 1..594 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30745694..30746286 | 1..594 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30745694..30746286 | 1..594 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26571416..26572008 | 1..594 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30486525..30487117 | 1..594 | 99 | Minus |
Translation from 3 to 500
> RH04252.hyp SASDFRSIMLRLSSLLPVAFALVLSSVSAEIVNFQTCEDSVDSCSISQVR VTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTLVASLGWAKSENVEL PLLTMDQEACKYTTCPVRSGVTQTYTNNMPADARFPLSPYTIRWALKDPV SQKRCCFTIDIKVVR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2h-PC | 157 | CG11315-PC | 1..157 | 9..165 | 827 | 100 | Plus |
Npc2h-PA | 157 | CG11315-PA | 1..157 | 9..165 | 827 | 100 | Plus |
Npc2g-PB | 159 | CG11314-PB | 1..159 | 9..165 | 643 | 78 | Plus |
Npc2g-PA | 159 | CG11314-PA | 1..159 | 9..165 | 643 | 78 | Plus |
Npc2h-PB | 130 | CG11315-PB | 1..130 | 9..165 | 638 | 82.2 | Plus |
Translation from 27 to 500
> RH04252.pep MLRLSSLLPVAFALVLSSVSAEIVNFQTCEDSVDSCSISQVRVTPCPEAN ANAACHIRRRHRFTMSFDFTPHFDADTLVASLGWAKSENVELPLLTMDQE ACKYTTCPVRSGVTQTYTNNMPADARFPLSPYTIRWALKDPVSQKRCCFT IDIKVVR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23312-PA | 157 | GF23312-PA | 1..157 | 1..157 | 553 | 70.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11913-PA | 161 | GG11913-PA | 1..161 | 1..157 | 657 | 77 | Plus |
Dere\GG11911-PA | 132 | GG11911-PA | 1..132 | 1..157 | 569 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14101-PA | 133 | GH14101-PA | 21..133 | 21..157 | 366 | 54 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Npc2h-PC | 157 | CG11315-PC | 1..157 | 1..157 | 827 | 100 | Plus |
Npc2h-PA | 157 | CG11315-PA | 1..157 | 1..157 | 827 | 100 | Plus |
Npc2g-PB | 159 | CG11314-PB | 1..159 | 1..157 | 643 | 78 | Plus |
Npc2g-PA | 159 | CG11314-PA | 1..159 | 1..157 | 643 | 78 | Plus |
Npc2h-PB | 130 | CG11315-PB | 1..130 | 1..157 | 638 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10632-PA | 131 | GI10632-PA | 23..131 | 22..157 | 335 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13990-PA | 160 | GL13990-PA | 14..160 | 11..157 | 535 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10910-PA | 160 | GA10910-PA | 14..160 | 11..157 | 535 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12131-PA | 159 | GM12131-PA | 1..159 | 1..157 | 651 | 77.4 | Plus |
Dsec\GM12130-PA | 130 | GM12130-PA | 1..130 | 1..157 | 638 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16847-PA | 159 | GD16847-PA | 1..159 | 1..157 | 653 | 77.4 | Plus |
Dsim\GD16836-PA | 130 | GD16836-PA | 1..130 | 1..157 | 641 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22989-PA | 157 | GJ22989-PA | 20..157 | 20..157 | 533 | 71 | Plus |
Dvir\GJ22987-PA | 158 | GJ22987-PA | 20..158 | 19..157 | 521 | 69.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13111-PA | 156 | GK13111-PA | 1..156 | 1..157 | 558 | 65.6 | Plus |