Clone RH04252 Report

Search the DGRC for RH04252

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:42
Well:52
Vector:pFlc-1
Associated Gene/TranscriptNpc2h-RA
Protein status:RH04252.pep: gold
Sequenced Size:609

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11315 2001-12-17 Blastp of sequenced clone
CG11315 2002-01-01 Sim4 clustering to Release 2
CG11315 2003-01-01 Sim4 clustering to Release 3
CG11315 2008-04-29 Release 5.5 accounting
CG11315 2008-08-15 Release 5.9 accounting
CG11315 2008-12-18 5.12 accounting

Clone Sequence Records

RH04252.complete Sequence

609 bp (609 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071674

> RH04252.complete
GATTCCGCGTCCGACTTTCGATCCATCATGTTGCGTCTGAGTTCGCTCCT
GCCTGTCGCCTTTGCTCTGGTGTTGTCATCCGTCTCCGCTGAGATAGTCA
ACTTTCAGACTTGCGAAGATAGTGTGGACTCCTGCTCGATTAGTCAGGTG
CGGGTGACGCCCTGTCCGGAAGCCAATGCCAATGCCGCATGCCACATTCG
CCGGAGGCACCGCTTCACGATGAGCTTCGACTTTACGCCCCACTTCGATG
CGGACACCCTGGTGGCCAGCTTGGGCTGGGCCAAGAGCGAGAACGTGGAG
CTGCCCCTGCTTACCATGGACCAGGAGGCCTGCAAGTACACCACCTGCCC
CGTGAGATCCGGAGTCACCCAGACCTACACCAACAACATGCCCGCCGACG
CCAGGTTCCCGCTGAGTCCATACACCATCCGTTGGGCCCTGAAGGATCCG
GTTTCCCAGAAACGTTGCTGCTTCACCATCGACATCAAGGTGGTGCGCTA
GCAAGGTGCACTCCGTAATGGATGCTCCACTTAATATTTGGATTAATATA
TATCTTAAATATCTTCGAAATTAAAGTGATTTACAAGTGGGTCGAAAAAA
AAAAAAAAA

RH04252.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2h-RA 810 Npc2h-RA 3..596 2..595 2970 100 Plus
Npc2h-RB 729 Npc2h-RB 3..336 2..335 1670 100 Plus
Npc2h-RB 729 Npc2h-RB 337..515 417..595 895 100 Plus
Npc2g-RA 658 Npc2g-RA 226..506 219..499 865 87.1 Plus
Npc2g-RA 658 Npc2g-RA 3..61 2..60 160 84.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26568197..26568789 594..2 2965 100 Minus
chr3R 27901430 chr3R 26567259..26567762 499..2 910 79.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30745693..30746286 595..2 2970 100 Minus
3R 32079331 3R 30744756..30745259 499..2 925 79.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30486524..30487117 595..2 2970 100 Minus
3R 31820162 3R 30485587..30485867 499..219 865 87.1 Minus
3R 31820162 3R 30486032..30486090 60..2 160 84.7 Minus
Blast to na_te.dros performed on 2019-03-16 21:26:35 has no hits.

RH04252.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:27:24 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26568197..26568789 1..594 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:03 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG11315-RA 1..474 28..501 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:13 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2h-RA 1..474 28..501 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:18 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2h-RA 1..474 28..501 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:54 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG11315-RA 1..474 28..501 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:19:37 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2h-RA 1..474 28..501 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:06 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG11315-RA 1..595 1..594 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:13 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2h-RA 1..595 1..594 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:18 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2h-RA 1..595 1..594 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:54 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG11315-RA 1..595 1..594 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:19:37 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2h-RA 3..597 1..594 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:24 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30745694..30746286 1..594 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:24 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30745694..30746286 1..594 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:24 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30745694..30746286 1..594 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:18 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26571416..26572008 1..594 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:14 Download gff for RH04252.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30486525..30487117 1..594 99   Minus

RH04252.hyp Sequence

Translation from 3 to 500

> RH04252.hyp
SASDFRSIMLRLSSLLPVAFALVLSSVSAEIVNFQTCEDSVDSCSISQVR
VTPCPEANANAACHIRRRHRFTMSFDFTPHFDADTLVASLGWAKSENVEL
PLLTMDQEACKYTTCPVRSGVTQTYTNNMPADARFPLSPYTIRWALKDPV
SQKRCCFTIDIKVVR*

RH04252.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2h-PC 157 CG11315-PC 1..157 9..165 827 100 Plus
Npc2h-PA 157 CG11315-PA 1..157 9..165 827 100 Plus
Npc2g-PB 159 CG11314-PB 1..159 9..165 643 78 Plus
Npc2g-PA 159 CG11314-PA 1..159 9..165 643 78 Plus
Npc2h-PB 130 CG11315-PB 1..130 9..165 638 82.2 Plus

RH04252.pep Sequence

Translation from 27 to 500

> RH04252.pep
MLRLSSLLPVAFALVLSSVSAEIVNFQTCEDSVDSCSISQVRVTPCPEAN
ANAACHIRRRHRFTMSFDFTPHFDADTLVASLGWAKSENVELPLLTMDQE
ACKYTTCPVRSGVTQTYTNNMPADARFPLSPYTIRWALKDPVSQKRCCFT
IDIKVVR*

RH04252.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23312-PA 157 GF23312-PA 1..157 1..157 553 70.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11913-PA 161 GG11913-PA 1..161 1..157 657 77 Plus
Dere\GG11911-PA 132 GG11911-PA 1..132 1..157 569 72.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14101-PA 133 GH14101-PA 21..133 21..157 366 54 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2h-PC 157 CG11315-PC 1..157 1..157 827 100 Plus
Npc2h-PA 157 CG11315-PA 1..157 1..157 827 100 Plus
Npc2g-PB 159 CG11314-PB 1..159 1..157 643 78 Plus
Npc2g-PA 159 CG11314-PA 1..159 1..157 643 78 Plus
Npc2h-PB 130 CG11315-PB 1..130 1..157 638 82.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10632-PA 131 GI10632-PA 23..131 22..157 335 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13990-PA 160 GL13990-PA 14..160 11..157 535 66 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10910-PA 160 GA10910-PA 14..160 11..157 535 66 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12131-PA 159 GM12131-PA 1..159 1..157 651 77.4 Plus
Dsec\GM12130-PA 130 GM12130-PA 1..130 1..157 638 80.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16847-PA 159 GD16847-PA 1..159 1..157 653 77.4 Plus
Dsim\GD16836-PA 130 GD16836-PA 1..130 1..157 641 81.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22989-PA 157 GJ22989-PA 20..157 20..157 533 71 Plus
Dvir\GJ22987-PA 158 GJ22987-PA 20..158 19..157 521 69.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13111-PA 156 GK13111-PA 1..156 1..157 558 65.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23361-PA 159 GE23361-PA 1..159 1..157 665 78.6 Plus
Dyak\GE23360-PA 132 GE23360-PA 1..132 1..157 532 72.3 Plus