BDGP Sequence Production Resources |
Search the DGRC for RH04491
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 44 |
Well: | 91 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG30423-RE |
Protein status: | RH04491.pep: gold |
Preliminary Size: | 3035 |
Sequenced Size: | 643 |
Gene | Date | Evidence |
---|---|---|
CG30423 | 2002-10-24 | Blastp of sequenced clone |
CG30423 | 2008-04-29 | Release 5.5 accounting |
CG30423 | 2008-08-15 | Release 5.9 accounting |
CG30423 | 2008-12-18 | 5.12 accounting |
643 bp (643 high quality bases) assembled on 2002-10-24
GenBank Submission: BT001754
> RH04491.complete GACTACACATCTGAGTCATTTTTAGGAGCGACAAAGGAAAAATTATAAAC AAATACAATGGCCACCTTAAAGGCCCTCTTCATCTGCGCCTTTCTTACAT GCATTGGTGTTACCTTCCTGATCCTGGCCTGCGCCGTGCCCACGACAAAG ATTTTCTATCCCTTCTTCGTTTTGCTGTTCTACGTGCTGTCAGTTCTTCC AGTCTTCATTGCCAGGAGGACAACTCCTGGAAATGAGACCAATCCGAAAT CGGAGTTTGCTCACTTCCTTACCGCGGGAATGGTGCTGAGTGCCTTCGCC CTGCCCATCGTCCTAGCCCACGCATTGGTGATCACCTGGACGGCGAGTAT CCTGACGATAATAAGTAACATTATTAACTACGGCACCATCTTCTGGTACG CCATGCGCGATGACGAGCCATACGGATCCATGTTCTAGAGGGGATTTGTA GTTCACAAGCTCACTAGGCTAGTAACCGGCGCAGGAATATCACCGATGCA CTGGGTCCTAGGGTTACGGCCATTTATCCGTAAGCACGCATGCTGTTCGC TTATCCGCAGTCATCAACAAATCTCATATAATCAAATGTATCCAGATAAA CGCAAACAAAATAAACTGACGTAGTAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 20760935..20761232 | 627..330 | 1490 | 100 | Minus |
chr2R | 21145070 | chr2R | 20761297..20761552 | 330..75 | 1280 | 100 | Minus |
chr2R | 21145070 | chr2R | 20761724..20761795 | 73..2 | 360 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 24874975..24875273 | 628..330 | 1495 | 100 | Minus |
2R | 25286936 | 2R | 24875338..24875593 | 330..75 | 1280 | 100 | Minus |
2R | 25286936 | 2R | 24875765..24875836 | 73..2 | 360 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 24876174..24876472 | 628..330 | 1495 | 100 | Minus |
2R | 25260384 | 2R | 24876537..24876792 | 330..75 | 1280 | 100 | Minus |
2R | 25260384 | 2R | 24876964..24877035 | 73..2 | 360 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 20760935..20761231 | 331..627 | 100 | <- | Minus |
chr2R | 20761297..20761552 | 74..330 | 99 | <- | Minus |
chr2R | 20761724..20761795 | 1..73 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RC | 1..381 | 58..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RC | 1..381 | 58..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RD | 1..381 | 58..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RB | 1..381 | 58..438 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RE | 1..381 | 58..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RC | 1..626 | 2..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RC | 1..626 | 2..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RD | 28..655 | 1..627 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RB | 1..626 | 2..627 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30423-RE | 28..655 | 1..627 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24875765..24875836 | 1..73 | 98 | Minus | |
2R | 24874976..24875272 | 331..627 | 100 | <- | Minus |
2R | 24875338..24875593 | 74..330 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24875765..24875836 | 1..73 | 98 | Minus | |
2R | 24874976..24875272 | 331..627 | 100 | <- | Minus |
2R | 24875338..24875593 | 74..330 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24875765..24875836 | 1..73 | 98 | Minus | |
2R | 24874976..24875272 | 331..627 | 100 | <- | Minus |
2R | 24875338..24875593 | 74..330 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 20762499..20762795 | 331..627 | 100 | <- | Minus |
arm_2R | 20762861..20763116 | 74..330 | 99 | <- | Minus |
arm_2R | 20763288..20763359 | 1..73 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24876193..24876489 | 331..627 | 100 | <- | Minus |
2R | 24876555..24876810 | 74..330 | 99 | <- | Minus |
2R | 24876982..24877053 | 1..73 | 98 | Minus |
Translation from 57 to 437
> RH04491.pep MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVF IARRTTPGNETNPKSEFAHFLTAGMVLSAFALPIVLAHALVITWTASILT IISNIINYGTIFWYAMRDDEPYGSMF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11533-PA | 112 | GF11533-PA | 1..112 | 16..126 | 448 | 78.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19881-PA | 148 | GG19881-PA | 29..148 | 7..126 | 568 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21531-PA | 112 | GH21531-PA | 1..112 | 18..126 | 440 | 77.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30423-PE | 126 | CG30423-PE | 1..126 | 1..126 | 651 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19503-PA | 114 | GI19503-PA | 1..114 | 18..126 | 446 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16781-PA | 109 | GL16781-PA | 1..109 | 18..126 | 461 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24290-PB | 125 | GA24290-PB | 6..125 | 7..126 | 510 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11783-PA | 168 | GM11783-PA | 47..168 | 5..126 | 614 | 97.5 | Plus |
Dsec\GM19752-PA | 113 | GM19752-PA | 1..113 | 14..126 | 570 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24911-PA | 148 | GD24911-PA | 29..148 | 7..126 | 613 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21072-PA | 110 | GJ21072-PA | 1..110 | 18..126 | 443 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21640-PA | 129 | GK21640-PA | 1..129 | 1..126 | 504 | 78.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11406-PA | 148 | GE11406-PA | 29..148 | 7..126 | 567 | 92.5 | Plus |
Translation from 279 to 437
> RH04491.hyp MVLSAFALPIVLAHALVITWTASILTIISNIINYGTIFWYAMRDDEPYGS MF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30423-PE | 126 | CG30423-PE | 75..126 | 1..52 | 268 | 100 | Plus |