Clone RH04491 Report

Search the DGRC for RH04491

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:44
Well:91
Vector:pFlc-1
Associated Gene/TranscriptCG30423-RE
Protein status:RH04491.pep: gold
Preliminary Size:3035
Sequenced Size:643

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30423 2002-10-24 Blastp of sequenced clone
CG30423 2008-04-29 Release 5.5 accounting
CG30423 2008-08-15 Release 5.9 accounting
CG30423 2008-12-18 5.12 accounting

Clone Sequence Records

RH04491.complete Sequence

643 bp (643 high quality bases) assembled on 2002-10-24

GenBank Submission: BT001754

> RH04491.complete
GACTACACATCTGAGTCATTTTTAGGAGCGACAAAGGAAAAATTATAAAC
AAATACAATGGCCACCTTAAAGGCCCTCTTCATCTGCGCCTTTCTTACAT
GCATTGGTGTTACCTTCCTGATCCTGGCCTGCGCCGTGCCCACGACAAAG
ATTTTCTATCCCTTCTTCGTTTTGCTGTTCTACGTGCTGTCAGTTCTTCC
AGTCTTCATTGCCAGGAGGACAACTCCTGGAAATGAGACCAATCCGAAAT
CGGAGTTTGCTCACTTCCTTACCGCGGGAATGGTGCTGAGTGCCTTCGCC
CTGCCCATCGTCCTAGCCCACGCATTGGTGATCACCTGGACGGCGAGTAT
CCTGACGATAATAAGTAACATTATTAACTACGGCACCATCTTCTGGTACG
CCATGCGCGATGACGAGCCATACGGATCCATGTTCTAGAGGGGATTTGTA
GTTCACAAGCTCACTAGGCTAGTAACCGGCGCAGGAATATCACCGATGCA
CTGGGTCCTAGGGTTACGGCCATTTATCCGTAAGCACGCATGCTGTTCGC
TTATCCGCAGTCATCAACAAATCTCATATAATCAAATGTATCCAGATAAA
CGCAAACAAAATAAACTGACGTAGTAGAAAAAAAAAAAAAAAA

RH04491.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG30423-RC 709 CG30423-RC 38..664 2..628 3135 100 Plus
CG30423.a 597 CG30423.a 1..532 2..533 2645 99.8 Plus
CG30423.a 597 CG30423.a 529..561 596..628 165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20760935..20761232 627..330 1490 100 Minus
chr2R 21145070 chr2R 20761297..20761552 330..75 1280 100 Minus
chr2R 21145070 chr2R 20761724..20761795 73..2 360 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24874975..24875273 628..330 1495 100 Minus
2R 25286936 2R 24875338..24875593 330..75 1280 100 Minus
2R 25286936 2R 24875765..24875836 73..2 360 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24876174..24876472 628..330 1495 100 Minus
2R 25260384 2R 24876537..24876792 330..75 1280 100 Minus
2R 25260384 2R 24876964..24877035 73..2 360 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:07:32 has no hits.

RH04491.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:08:16 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20760935..20761231 331..627 100 <- Minus
chr2R 20761297..20761552 74..330 99 <- Minus
chr2R 20761724..20761795 1..73 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:14 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RC 1..381 58..438 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:09:08 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RC 1..381 58..438 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:13 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RD 1..381 58..438 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:00:03 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RB 1..381 58..438 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:58:48 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RE 1..381 58..438 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:29:51 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RC 1..626 2..627 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:09:07 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RC 1..626 2..627 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:13 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RD 28..655 1..627 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:00:03 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RB 1..626 2..627 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:58:48 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
CG30423-RE 28..655 1..627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:16 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24875765..24875836 1..73 98   Minus
2R 24874976..24875272 331..627 100 <- Minus
2R 24875338..24875593 74..330 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:16 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24875765..24875836 1..73 98   Minus
2R 24874976..24875272 331..627 100 <- Minus
2R 24875338..24875593 74..330 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:16 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24875765..24875836 1..73 98   Minus
2R 24874976..24875272 331..627 100 <- Minus
2R 24875338..24875593 74..330 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:13 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20762499..20762795 331..627 100 <- Minus
arm_2R 20762861..20763116 74..330 99 <- Minus
arm_2R 20763288..20763359 1..73 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:31 Download gff for RH04491.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24876193..24876489 331..627 100 <- Minus
2R 24876555..24876810 74..330 99 <- Minus
2R 24876982..24877053 1..73 98   Minus

RH04491.pep Sequence

Translation from 57 to 437

> RH04491.pep
MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVF
IARRTTPGNETNPKSEFAHFLTAGMVLSAFALPIVLAHALVITWTASILT
IISNIINYGTIFWYAMRDDEPYGSMF*

RH04491.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11533-PA 112 GF11533-PA 1..112 16..126 448 78.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19881-PA 148 GG19881-PA 29..148 7..126 568 92.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21531-PA 112 GH21531-PA 1..112 18..126 440 77.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG30423-PE 126 CG30423-PE 1..126 1..126 651 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19503-PA 114 GI19503-PA 1..114 18..126 446 78.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16781-PA 109 GL16781-PA 1..109 18..126 461 83.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24290-PB 125 GA24290-PB 6..125 7..126 510 83.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11783-PA 168 GM11783-PA 47..168 5..126 614 97.5 Plus
Dsec\GM19752-PA 113 GM19752-PA 1..113 14..126 570 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24911-PA 148 GD24911-PA 29..148 7..126 613 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21072-PA 110 GJ21072-PA 1..110 18..126 443 80 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21640-PA 129 GK21640-PA 1..129 1..126 504 78.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11406-PA 148 GE11406-PA 29..148 7..126 567 92.5 Plus

RH04491.hyp Sequence

Translation from 279 to 437

> RH04491.hyp
MVLSAFALPIVLAHALVITWTASILTIISNIINYGTIFWYAMRDDEPYGS
MF*

RH04491.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG30423-PE 126 CG30423-PE 75..126 1..52 268 100 Plus