![]() | BDGP Sequence Production Resources |
Search the DGRC for RH04493
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 44 |
Well: | 93 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS11-RB |
Protein status: | RH04493.pep: gold |
Sequenced Size: | 588 |
Gene | Date | Evidence |
---|---|---|
RpS11 | 2009-04-06 | Manual selection by Sue Celniker |
588 bp assembled on 2009-05-29
GenBank Submission: BT088762.1
> RH04493.complete GTTTGCCTTTTTCATCAACATGGCTGATCAGCAAACCGAACGCTCGTTCC GCAAGCAACACGCGGTGGTCGTTGTGCGTCGCAAGAGCCCCAACTTGAAG AAAAGGCCCCGTTTCTATCGCCAAATTGGCCTGGGCTTCCGCGCTCCGGC GGAGGCCATCGATGGTACCTACATCGACAAGAAGTGCCCCTGGACCGGTG ATGTGAGGATCCGTGGTCGCATTCTGACCGGCGTGGTCCGCAAGGCCAAG ATGCAGCGCACCATTGTCATTCGGCGCGACTACCTGCACTTTGTGCGCAA ATACAGCCGTTTCGAGAAGCGTCACCGCAACATGAGCGTCCACTGCTCCC CTGTGTTCAGAGATGTTGAGCATGGCGATATTGTCACCATTGGTGAGTGC CGTCCTCTGTCCAAGACTGTGCGCTTCAACGTCCTGAAAGTCAGCAAGGG TCAGGGAGCCAAGAAGAGCTTCAAGAAGTACTAGAGCGGACAACTACCAT TCGGGCGATAATATTTGTAGCAATTATTCTTTTTGAATAAAACAAAAAAA AGTAACTTTAAAAAAAAAAAAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS11-RB | 768 | RpS11-RB | 44..599 | 6..561 | 2780 | 100 | Plus |
RpS11.a | 897 | RpS11.a | 319..728 | 152..561 | 2050 | 100 | Plus |
RpS11-RC | 894 | RpS11-RC | 315..724 | 152..561 | 2050 | 100 | Plus |
RpS11.a | 897 | RpS11.a | 47..195 | 6..154 | 745 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 8087050..8087257 | 360..153 | 1040 | 100 | Minus |
chr2R | 21145070 | chr2R | 8086605..8086808 | 561..358 | 1020 | 100 | Minus |
chr2R | 21145070 | chr2R | 8087643..8087769 | 155..29 | 635 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 12199834..12200041 | 360..153 | 1040 | 100 | Minus |
2R | 25286936 | 2R | 12199389..12199592 | 561..358 | 1020 | 100 | Minus |
2R | 25286936 | 2R | 12200427..12200553 | 155..29 | 635 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 12201033..12201240 | 360..153 | 1040 | 100 | Minus |
2R | 25260384 | 2R | 12200588..12200791 | 561..358 | 1020 | 100 | Minus |
2R | 25260384 | 2R | 12201626..12201752 | 155..29 | 635 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8087050..8087255 | 155..360 | 100 | <- | Minus |
chr2R | 8087644..8087766 | 32..154 | 100 | <- | Minus |
chr2R | 8087991..8088019 | 1..31 | 93 | Minus | |
chr2R | 8086607..8086805 | 361..559 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 1..465 | 20..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 1..465 | 20..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 1..465 | 20..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 1..465 | 20..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 25..582 | 1..559 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 25..582 | 1..559 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 12..569 | 1..559 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS11-RB | 12..569 | 1..559 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12199391..12199589 | 361..559 | 100 | <- | Minus |
2R | 12199834..12200039 | 155..360 | 100 | <- | Minus |
2R | 12200428..12200550 | 32..154 | 100 | <- | Minus |
2R | 12200775..12200803 | 1..31 | 93 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12199391..12199589 | 361..559 | 100 | <- | Minus |
2R | 12199834..12200039 | 155..360 | 100 | <- | Minus |
2R | 12200428..12200550 | 32..154 | 100 | <- | Minus |
2R | 12200775..12200803 | 1..31 | 93 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12199391..12199589 | 361..559 | 100 | <- | Minus |
2R | 12199834..12200039 | 155..360 | 100 | <- | Minus |
2R | 12200428..12200550 | 32..154 | 100 | <- | Minus |
2R | 12200775..12200803 | 1..31 | 93 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8087339..8087544 | 155..360 | 100 | <- | Minus |
arm_2R | 8087933..8088055 | 32..154 | 100 | <- | Minus |
arm_2R | 8088280..8088308 | 1..31 | 93 | Minus | |
arm_2R | 8086896..8087094 | 361..559 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12201033..12201238 | 155..360 | 100 | <- | Minus |
2R | 12201627..12201749 | 32..154 | 100 | <- | Minus |
2R | 12201974..12202002 | 1..31 | 93 | Minus | |
2R | 12200590..12200788 | 361..559 | 100 | <- | Minus |
Translation from 1 to 483
> RH04493.pep FAFFINMADQQTERSFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPA EAIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRK YSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSKG QGAKKSFKKY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12077-PA | 196 | GF12077-PA | 1..196 | 7..160 | 740 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22596-PA | 196 | GG22596-PA | 1..196 | 7..160 | 756 | 78.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22980-PA | 196 | GH22980-PA | 1..196 | 7..160 | 665 | 69.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS11-PB | 154 | CG8857-PB | 1..154 | 7..160 | 807 | 100 | Plus |
RpS11-PC | 155 | CG8857-PC | 1..155 | 7..160 | 660 | 83.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18949-PA | 196 | GI18949-PA | 1..196 | 7..160 | 693 | 71.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11264-PA | 196 | GL11264-PA | 1..196 | 7..160 | 712 | 73.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21371-PA | 196 | GA21371-PA | 1..196 | 7..160 | 712 | 73.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20375-PA | 196 | GM20375-PA | 1..196 | 7..160 | 748 | 77.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15239-PA | 196 | GD15239-PA | 1..196 | 7..160 | 754 | 78.1 | Plus |
Dsim\GD25853-PA | 115 | GD25853-PA | 6..115 | 51..160 | 577 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21555-PA | 196 | GJ21555-PA | 1..196 | 7..160 | 686 | 71.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22117-PA | 196 | GK22117-PA | 1..196 | 7..160 | 703 | 73 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13464-PA | 196 | GE13464-PA | 1..196 | 7..160 | 756 | 78.6 | Plus |
Translation from 3 to 483
> RH04493.hyp SFFINMADQQTERSFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPAE AIDGTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKY SRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSKGQ GAKKSFKKY*