Clone RH04549 Report

Search the DGRC for RH04549

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:45
Well:49
Vector:pFlc-1
Associated Gene/TranscriptObp44a-RA
Protein status:RH04549.pep: gold
Preliminary Size:649
Sequenced Size:661

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2297 2001-12-13 Blastp of sequenced clone
CG2297 2002-01-01 Sim4 clustering to Release 2
CG2297 2003-01-01 Sim4 clustering to Release 3
Obp44a 2008-04-29 Release 5.5 accounting
Obp44a 2008-08-15 Release 5.9 accounting
Obp44a 2008-12-18 5.12 accounting

Clone Sequence Records

RH04549.complete Sequence

661 bp (661 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070662

> RH04549.complete
GAACAGTTTCCTCCGAGCGAGCATTCAGTCCTCACACAATCTATCACAGA
AGCCAAAAAAAATAAGATTCACCATGAAGAACGCTGTTGCTATTCTGCTG
TGCGCCCTGCTGGGTCTGGCCTCTGCCTCCGACTACAAGCTGCGCACCGC
CGAGGATCTGCAGAGCGCGCGCAAGGAGTGTGCCGCCAGCAGCAAGGTGA
CCGAGGCCCTGATCGCCAAGTACAAGACCTTCGACTATCCCGACGATGAC
ATCACCCGCAACTACATCCAGTGCATCTTCGTCAAATTCGACCTGTTCGA
TGAGGCCAAGGGCTTCAAGGTGGAGAACCTGGTGGCGCAACTGGGCCAGG
GCAAGGAGGACAAGGCCGCGCTGAAGGCCGACATCGAGAAGTGCGCCGAC
AAGAACGAGCAGAAGTCGCCCGCCAACGAATGGGCCTTCCGTGGCTTCAA
GTGTTTCCTTGGCAAGAACCTGCCCCTCGTGCAGGCCGCCGTCCAGAAGA
ACTAGGAGTTCAGCGCAGTTCCACATCAATTCTAGAAGCGAAAGATCAAT
CAACACGCAAGCAACGCGGCATTTTCGAGTTGAAATCCGCTCAGGCTCTG
CAATCCTACGATTGAAATAAAACCATATAATAGTGCTTTTGAACGAAAAA
AAAAAAAAAAA

RH04549.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Obp44a-RA 741 Obp44a-RA 93..738 2..647 3215 99.8 Plus
Pabp2-RA 1949 Pabp2-RA 1909..1949 647..607 190 97.5 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4021876..4022401 643..118 2630 100 Minus
chr2R 21145070 chr2R 4022470..4022586 119..2 540 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8134368..8134897 647..118 2635 99.8 Minus
2R 25286936 2R 8134966..8135083 119..2 590 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8135567..8136096 647..118 2635 99.8 Minus
2R 25260384 2R 8136165..8136282 119..2 590 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:53:52 has no hits.

RH04549.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:54:57 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4021874..4022400 119..645 99 <- Minus
chr2R 4022471..4022586 1..118 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:15 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 1..432 74..505 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:03 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 1..432 74..505 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:13:15 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 1..432 74..505 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:30 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 1..432 74..505 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:11:18 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 1..432 74..505 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:38 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 8..652 1..645 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:03 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 1..644 2..645 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:13:15 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 4..648 1..645 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:30 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 8..652 1..645 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:11:18 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
Obp44a-RA 4..648 1..645 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:54:57 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8134370..8134896 119..645 99 <- Minus
2R 8134967..8135083 1..118 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:54:57 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8134370..8134896 119..645 99 <- Minus
2R 8134967..8135083 1..118 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:54:57 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8134370..8134896 119..645 99 <- Minus
2R 8134967..8135083 1..118 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:13:15 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4021875..4022401 119..645 99 <- Minus
arm_2R 4022472..4022588 1..118 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:11 Download gff for RH04549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8135569..8136095 119..645 99 <- Minus
2R 8136166..8136282 1..118 99   Minus

RH04549.hyp Sequence

Translation from 0 to 504

> RH04549.hyp
NSFLRASIQSSHNLSQKPKKIRFTMKNAVAILLCALLGLASASDYKLRTA
EDLQSARKECAASSKVTEALIAKYKTFDYPDDDITRNYIQCIFVKFDLFD
EAKGFKVENLVAQLGQGKEDKAALKADIEKCADKNEQKSPANEWAFRGFK
CFLGKNLPLVQAAVQKN*

RH04549.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
Obp44a-PB 143 CG2297-PB 1..143 25..167 732 100 Plus
Obp44a-PA 143 CG2297-PA 1..143 25..167 732 100 Plus
Obp99a-PB 142 CG18111-PB 3..138 29..164 278 42.3 Plus
Obp99a-PA 142 CG18111-PA 3..138 29..164 278 42.3 Plus
Obp99b-PB 149 CG7592-PB 3..148 31..165 216 34.9 Plus

RH04549.pep Sequence

Translation from 73 to 504

> RH04549.pep
MKNAVAILLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKY
KTFDYPDDDITRNYIQCIFVKFDLFDEAKGFKVENLVAQLGQGKEDKAAL
KADIEKCADKNEQKSPANEWAFRGFKCFLGKNLPLVQAAVQKN*

RH04549.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11209-PA 144 GF11209-PA 1..142 1..142 613 78.9 Plus
Dana\GF23357-PA 142 GF23357-PA 3..138 5..140 264 38.7 Plus
Dana\GF22870-PA 151 GF22870-PA 28..150 21..141 189 33.1 Plus
Dana\GF18627-PA 145 GF18627-PA 1..141 1..137 184 29.1 Plus
Dana\GF22873-PA 146 GF22873-PA 6..130 7..133 178 27.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10672-PA 143 GG10672-PA 1..143 1..143 721 97.2 Plus
Dere\GG11676-PA 144 GG11676-PA 3..140 5..140 267 39.1 Plus
Dere\GG10577-PA 145 GG10577-PA 11..141 4..137 199 33.3 Plus
Dere\GG12008-PA 151 GG12008-PA 7..131 5..133 193 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19983-PA 144 GH19983-PA 1..142 1..142 595 76.8 Plus
Dgri\GH18907-PA 149 GH18907-PA 1..141 1..143 269 40.3 Plus
Dgri\GH18683-PA 151 GH18683-PA 7..132 5..133 211 33.3 Plus
Dgri\GH13991-PA 157 GH13991-PA 32..156 19..141 206 34.6 Plus
Dgri\GH14285-PA 149 GH14285-PA 1..142 1..137 196 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
Obp44a-PB 143 CG2297-PB 1..143 1..143 732 100 Plus
Obp44a-PA 143 CG2297-PA 1..143 1..143 732 100 Plus
Obp99a-PB 142 CG18111-PB 3..138 5..140 278 42.3 Plus
Obp99a-PA 142 CG18111-PA 3..138 5..140 278 42.3 Plus
Obp99b-PB 149 CG7592-PB 3..148 7..141 216 34.9 Plus
Obp99b-PA 149 CG7592-PA 3..148 7..141 216 34.9 Plus
Obp99c-PA 151 CG7584-PA 7..131 5..133 191 28.7 Plus
Obp83g-PA 146 CG31558-PA 12..142 4..137 171 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20270-PA 144 GI20270-PA 1..142 1..142 633 82.4 Plus
Dmoj\GI23406-PA 142 GI23406-PA 1..138 1..140 293 43.3 Plus
Dmoj\GI22335-PA 154 GI22335-PA 27..153 17..141 231 39.4 Plus
Dmoj\GI23179-PA 147 GI23179-PA 9..143 4..137 202 31.9 Plus
Dmoj\GI24193-PA 151 GI24193-PA 7..132 5..133 189 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17379-PA 144 GL17379-PA 1..144 1..143 646 85.4 Plus
Dper\GL13898-PA 142 GL13898-PA 3..138 5..140 267 40.1 Plus
Dper\GL13580-PA 156 GL13580-PA 29..155 18..141 217 35.4 Plus
Dper\GL13581-PA 151 GL13581-PA 6..132 7..133 185 32.8 Plus
Dper\GL23482-PA 145 GL23482-PA 20..141 17..137 150 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp44a-PA 144 GA15343-PA 1..144 1..143 646 85.4 Plus
Dpse\Obp99a-PA 142 GA14801-PA 3..138 5..140 267 40.1 Plus
Dpse\Obp99b-PA 156 GA20463-PA 29..155 18..141 217 35.4 Plus
Dpse\Obp99c-PA 135 GA26831-PA 17..116 33..133 165 33.7 Plus
Dpse\Obp83g-PA 145 GA16322-PA 20..141 17..137 145 26.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20719-PA 143 GM20719-PA 1..143 1..143 732 99.3 Plus
Dsec\GM12800-PA 142 GM12800-PA 3..138 5..140 282 43.1 Plus
Dsec\GM12228-PA 149 GM12228-PA 3..148 7..141 233 34.9 Plus
Dsec\GM12230-PA 151 GM12230-PA 6..131 7..133 191 29.1 Plus
Dsec\GM10567-PA 145 GM10567-PA 10..141 3..137 183 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp44a-PA 143 GD10185-PA 1..143 1..143 737 100 Plus
Dsim\Obp99a-PA 142 GD21447-PA 3..138 5..140 281 42.3 Plus
Dsim\Obp99b-PA 149 GD17685-PA 3..148 7..141 233 34.9 Plus
Dsim\Obp99c-PA 151 GD17690-PA 7..131 5..133 193 30.2 Plus
Dsim\Obp83g-PA 145 GD19559-PA 11..141 4..137 179 31.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp44a-PA 144 GJ20223-PA 1..142 1..142 623 81.7 Plus
Dvir\Obp99a-PA 142 GJ10612-PA 1..138 1..140 268 41.8 Plus
Dvir\Obp99b-PA 162 GJ10523-PA 35..161 17..141 221 37.2 Plus
Dvir\Obp83g-PA 148 GJ14492-PA 9..148 4..143 197 31.2 Plus
Dvir\Obp99c-PA 155 GJ10540-PA 6..132 7..133 183 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23043-PA 144 GK23043-PA 1..142 1..142 638 84.5 Plus
Dwil\GK11170-PA 158 GK11170-PA 33..157 21..141 260 43.2 Plus
Dwil\GK11908-PA 142 GK11908-PA 1..127 1..129 245 41.5 Plus
Dwil\GK11172-PA 151 GK11172-PA 7..132 5..133 187 30.2 Plus
Dwil\GK14209-PA 144 GK14209-PA 9..140 7..137 186 30.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23275-PA 143 GE23275-PA 1..143 1..143 710 95.1 Plus
Dyak\Obp99a-PA 144 GE23865-PA 3..140 5..140 291 42 Plus
Dyak\GE10437-PA 149 GE10437-PA 3..148 7..141 239 34.9 Plus
Dyak\Obp99c-PA 151 GE10439-PA 7..131 5..133 197 31 Plus
Dyak\GE24115-PA 145 GE24115-PA 11..141 4..137 184 32.6 Plus