Clone RH04757 Report

Search the DGRC for RH04757

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:47
Well:57
Vector:pFlc-1
Associated Gene/TranscriptArp1-RA
Protein status:RH04757.pep: gold
Sequenced Size:1498

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6174 2001-12-13 Blastp of sequenced clone
CG6174 2002-01-01 Sim4 clustering to Release 2
CG6174 2003-01-01 Sim4 clustering to Release 3
Arp87C 2008-04-29 Release 5.5 accounting
Arp87C 2008-08-15 Release 5.9 accounting
Arp87C 2008-12-18 5.12 accounting

Clone Sequence Records

RH04757.complete Sequence

1498 bp (1498 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070666

> RH04757.complete
GGCTGTTTATTTCTGCCAACCACCTACGGTCACCCTGTTGACCAACTATT
TAATAGAAAATTTGCAAATTTTGATAAACGCACAAAATGGAGCCTTATGA
TGTCGTCGTCAACCAGCCCGTCGTCATAGATAACGGCTCCGGTGTGATCA
AAGCCGGCTTTGCTGGTGAGCACATTCCAAAATGCAGGTTTCCCAATTAC
ATTGGCCGGCCCAAGCATGTCCGAGTGATGGCTGGTGCGCTGGAGGGCGA
CATATTCGTTGGACCCAAGGCGGAGGAGCACCGTGGCCTGCTTAGCATCC
GGTACCCCATGGAGCACGGCATTGTCACCGACTGGAATGACATGGAGCGG
ATATGGAGCTACATTTACAGCAAAGAACAACTGGCCACCTTCACGGAGGA
TCATCCCGTGCTGCTGACCGAGGCCCCGCTTAATCCGCGCCGAAACCGCG
AAAAGGCAGCCGAGTTCTTCTTTGAAGGCATCAATGCACCTGCGCTCTTT
GTGTCCATGCAGGCGGTGCTCAGTCTCTACGCCACCGGTCGTGTGACTGG
CGTAGTGCTCGACTCCGGCGACGGTGTGACGCATGCGGTTCCTATCTACG
AGGGATTCGCCATGCCTCACAGTATTATGCGCGTGGACATCGCCGGGCGC
GATGTGACGCGCTACCTGAAGACACTCATCCGCCGGGAGGGCTTTAACTT
CCGGTCGACTGCCGAATTTGAGATTGTGCGCTCCATCAAGGAGAAGGTCT
GCTATCTGGCCACCAATCCGCAGAAGGAGGAGACCGTGGAAACCGAGAAG
TTTGCCTACAAGCTGCCCGACGGCAAGATCTTTGAGATTGGACCTGCACG
CTTCAGGGCGCCGGAGGTGCTCTTCCGGCCCGATCTGCTGGGCGAGGAAT
GTGAGGGCATTCACGACGTTCTGATGTACTCCATCGAGAAGTCAGATATG
GATCTCAGGAAAATGCTCTACCAGAACATCGTGCTGTCCGGCGGATCAAC
GCTCTTCAAAGGATTCGGCGACCGTCTGTTGTCCGAACTGAAGAAACACT
CGGCTAAGGATCTCAAGATCAGGATCGCTGCGCCGCAGGAACGTCTGTAC
TCCACATGGATGGGCGGATCGATTTTAGCCTCGCTCGATACTTTCAAGAA
GATGTGGATCTCGAAGCGGGAATACGAGGAGGAGGGACAGAAAGCCGTGC
ACAGAAAGACTTTTTAGCCTGTTTATAAGCTTAAACGCCATTTGTAAAAG
GCTAATTAAAATGTATATCAAATCCTTGTGTCAGCTAACATGAAGTACCC
TATAAATTGAAAAGTAAAATGTGTATGTTTTACGCATCAAGGGCGCAAAG
TATTTAAAATGCTATTTATTGAAACTGCTTTCCCAGCCTAGAAAATAAAG
TACTAAAATTTATAATTCACTTGCGGATAATTCCTTCCCAGGTTAACTCT
TAAACAATAAACCAAGAAATTTCAACAAAAAGAAAAAAAAAAAAAAAA

RH04757.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Arp87C-RA 1543 Arp87C-RA 6..1482 2..1478 7385 100 Plus
CG31347-RA 865 CG31347-RA 728..861 135..2 670 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8518456..8519002 527..1073 2675 99.3 Plus
chr3R 27901430 chr3R 8519070..8519475 1073..1478 2015 99.8 Plus
chr3R 27901430 chr3R 8518011..8518186 200..375 880 100 Plus
chr3R 27901430 chr3R 8518245..8518396 375..526 760 100 Plus
chr3R 27901430 chr3R 8516978..8517111 2..135 670 100 Plus
chr3R 27901430 chr3R 8517884..8517948 135..199 325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12693215..12693761 527..1073 2735 100 Plus
3R 32079331 3R 12693829..12694234 1073..1478 2030 100 Plus
3R 32079331 3R 12692770..12692945 200..375 880 100 Plus
3R 32079331 3R 12693004..12693155 375..526 760 100 Plus
3R 32079331 3R 12691737..12691870 2..135 670 100 Plus
3R 32079331 3R 12692643..12692707 135..199 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12434046..12434592 527..1073 2735 100 Plus
3R 31820162 3R 12434660..12435065 1073..1478 2030 100 Plus
3R 31820162 3R 12433601..12433776 200..375 880 100 Plus
3R 31820162 3R 12433835..12433986 375..526 760 100 Plus
3R 31820162 3R 12432568..12432701 2..135 670 100 Plus
3R 31820162 3R 12433474..12433538 135..199 325 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:07:37 has no hits.

RH04757.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:08:19 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8516977..8517110 1..134 99 -> Plus
chr3R 8517884..8517948 135..199 100 -> Plus
chr3R 8518245..8518396 375..526 100 -> Plus
chr3R 8518011..8518185 200..374 100 -> Plus
chr3R 8518456..8519002 527..1073 99 -> Plus
chr3R 8519071..8519476 1074..1482 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:20 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp87C-RA 1..1131 87..1217 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:32 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp87C-RA 1..1131 87..1217 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:17 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp1-RA 1..1131 87..1217 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:40 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp87C-RA 1..1131 87..1217 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:58:56 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp1-RA 1..1131 87..1217 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:53 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp87C-RA 2..1476 2..1476 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:32 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp87C-RA 2..1476 2..1476 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:17 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp1-RA 1..1469 8..1476 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:40 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp87C-RA 2..1476 2..1476 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:58:56 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
Arp1-RA 1..1469 8..1476 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:19 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12691736..12691869 1..134 99 -> Plus
3R 12692643..12692707 135..199 100 -> Plus
3R 12693004..12693155 375..526 100 -> Plus
3R 12692770..12692944 200..374 100 -> Plus
3R 12693215..12693761 527..1073 100 -> Plus
3R 12693830..12694235 1074..1482 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:19 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12691736..12691869 1..134 99 -> Plus
3R 12692643..12692707 135..199 100 -> Plus
3R 12693004..12693155 375..526 100 -> Plus
3R 12692770..12692944 200..374 100 -> Plus
3R 12693215..12693761 527..1073 100 -> Plus
3R 12693830..12694235 1074..1482 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:19 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12691736..12691869 1..134 99 -> Plus
3R 12692643..12692707 135..199 100 -> Plus
3R 12693004..12693155 375..526 100 -> Plus
3R 12692770..12692944 200..374 100 -> Plus
3R 12693215..12693761 527..1073 100 -> Plus
3R 12693830..12694235 1074..1482 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:17 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8517458..8517591 1..134 99 -> Plus
arm_3R 8518365..8518429 135..199 100 -> Plus
arm_3R 8518492..8518666 200..374 100 -> Plus
arm_3R 8518726..8518877 375..526 100 -> Plus
arm_3R 8518937..8519483 527..1073 100 -> Plus
arm_3R 8519552..8519957 1074..1482 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:43 Download gff for RH04757.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12434046..12434592 527..1073 100 -> Plus
3R 12434661..12435066 1074..1482 99   Plus
3R 12432567..12432700 1..134 99 -> Plus
3R 12433474..12433538 135..199 100 -> Plus
3R 12433601..12433775 200..374 100 -> Plus
3R 12433835..12433986 375..526 100 -> Plus

RH04757.hyp Sequence

Translation from 86 to 1216

> RH04757.hyp
MEPYDVVVNQPVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAG
ALEGDIFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLA
TFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFVSMQAVLSLYAT
GRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRR
EGFNFRSTAEFEIVRSIKEKVCYLATNPQKEETVETEKFAYKLPDGKIFE
IGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVL
SGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASL
DTFKKMWISKREYEEEGQKAVHRKTF*

RH04757.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Arp1-PA 376 CG6174-PA 1..376 1..376 1961 100 Plus
Act87E-PC 376 CG18290-PC 9..376 12..376 1084 54.6 Plus
Act87E-PB 376 CG18290-PB 9..376 12..376 1084 54.6 Plus
Act87E-PA 376 CG18290-PA 9..376 12..376 1084 54.6 Plus
Act88F-PA 376 CG5178-PA 9..376 12..376 1083 54.9 Plus

RH04757.pep Sequence

Translation from 86 to 1216

> RH04757.pep
MEPYDVVVNQPVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAG
ALEGDIFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLA
TFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFVSMQAVLSLYAT
GRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRR
EGFNFRSTAEFEIVRSIKEKVCYLATNPQKEETVETEKFAYKLPDGKIFE
IGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVL
SGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASL
DTFKKMWISKREYEEEGQKAVHRKTF*

RH04757.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17116-PA 376 GF17116-PA 1..376 1..376 1976 97.3 Plus
Dana\GF17602-PA 376 GF17602-PA 9..376 12..376 1119 54.6 Plus
Dana\GF13827-PA 376 GF13827-PA 9..376 12..376 1119 54.2 Plus
Dana\GF18300-PA 376 GF18300-PA 9..376 12..376 1117 54.9 Plus
Dana\GF10940-PA 376 GF10940-PA 9..376 12..376 1116 54.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19181-PA 376 GG19181-PA 1..376 1..376 2003 99.5 Plus
Dere\GG19688-PA 376 GG19688-PA 9..376 12..376 1119 54.6 Plus
Dere\GG16929-PA 376 GG16929-PA 9..376 12..376 1117 54.9 Plus
Dere\GG18797-PA 376 GG18797-PA 9..376 12..376 1116 54.2 Plus
Dere\GG16241-PA 376 GG16241-PA 9..376 12..376 1116 54.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21372-PA 376 GH21372-PA 1..376 1..376 1972 97.9 Plus
Dgri\GH19077-PA 376 GH19077-PA 9..376 12..376 1120 54.9 Plus
Dgri\GH19045-PA 376 GH19045-PA 9..376 12..376 1119 54.6 Plus
Dgri\GH20408-PA 376 GH20408-PA 9..376 12..376 1118 54.2 Plus
Dgri\GH24372-PA 376 GH24372-PA 9..376 12..376 1116 54.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Arp1-PA 376 CG6174-PA 1..376 1..376 1961 100 Plus
Act87E-PC 376 CG18290-PC 9..376 12..376 1084 54.6 Plus
Act87E-PB 376 CG18290-PB 9..376 12..376 1084 54.6 Plus
Act87E-PA 376 CG18290-PA 9..376 12..376 1084 54.6 Plus
Act88F-PA 376 CG5178-PA 9..376 12..376 1083 54.9 Plus
Act79B-PB 376 CG7478-PB 9..376 12..376 1082 54.3 Plus
Act79B-PA 376 CG7478-PA 9..376 12..376 1082 54.3 Plus
Act57B-PA 376 CG10067-PA 9..376 12..376 1081 54.3 Plus
Act5C-PE 376 CG4027-PE 9..376 12..376 1080 54.2 Plus
Act5C-PD 376 CG4027-PD 9..376 12..376 1080 54.2 Plus
Act5C-PC 376 CG4027-PC 9..376 12..376 1080 54.2 Plus
Act5C-PA 376 CG4027-PA 9..376 12..376 1080 54.2 Plus
Act5C-PB 376 CG4027-PB 9..376 12..376 1080 54.2 Plus
Act42A-PA 376 CG12051-PA 9..376 12..376 1079 54.2 Plus
Arp53D-PB 411 CG5409-PB 49..411 12..376 1001 51.8 Plus
Arp2-PB 394 CG9901-PB 9..388 12..373 783 41.3 Plus
Arp2-PA 394 CG9901-PA 9..388 12..373 783 41.3 Plus
Arp2-PC 399 CG9901-PC 9..393 12..373 777 41.3 Plus
Arp3-PB 418 CG7558-PB 9..404 13..367 546 34.8 Plus
Arp3-PA 418 CG7558-PA 9..404 13..367 546 34.8 Plus
Bap55-PA 425 CG6546-PA 16..423 12..374 437 27.3 Plus
Arp6-PA 398 CG11678-PA 1..398 7..374 360 26 Plus
Arp5-PB 648 CG7940-PB 7..254 12..241 205 25.3 Plus
Arp5-PA 648 CG7940-PA 7..254 12..241 205 25.3 Plus
Arp5-PB 648 CG7940-PB 514..637 252..375 154 26.6 Plus
Arp5-PA 648 CG7940-PA 514..637 252..375 154 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10502-PA 376 GI10502-PA 1..376 1..376 1981 98.1 Plus
Dmoj\GI23222-PA 376 GI23222-PA 9..376 12..376 1120 54.9 Plus
Dmoj\GI24339-PA 376 GI24339-PA 9..376 12..376 1119 54.6 Plus
Dmoj\GI19595-PA 376 GI19595-PA 9..376 12..376 1119 54.5 Plus
Dmoj\GI15312-PA 376 GI15312-PA 9..376 12..376 1116 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24422-PA 376 GL24422-PA 1..376 1..376 1982 98.1 Plus
Dper\GL17787-PA 376 GL17787-PA 9..376 12..376 1118 54.2 Plus
Dper\GL14888-PA 376 GL14888-PA 9..376 12..376 1116 54.2 Plus
Dper\GL17061-PA 376 GL17061-PA 9..376 12..376 1115 54.3 Plus
Dper\GL26327-PA 376 GL26327-PA 9..376 12..376 1110 53.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19410-PA 376 GA19410-PA 1..376 1..376 1982 98.1 Plus
Dpse\GA14877-PB 376 GA14877-PB 9..376 12..376 1119 54.6 Plus
Dpse\GA14877-PA 376 GA14877-PA 9..376 12..376 1119 54.6 Plus
Dpse\GA24908-PB 376 GA24908-PB 9..376 12..376 1118 54.2 Plus
Dpse\GA24908-PA 376 GA24908-PA 9..376 12..376 1118 54.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24057-PA 376 GM24057-PA 1..376 1..376 2006 99.7 Plus
Dsec\GM12447-PA 376 GM12447-PA 9..376 12..376 1116 54.2 Plus
Dsec\GM22426-PA 376 GM22426-PA 9..376 12..376 1116 54.3 Plus
Dsec\GM16492-PA 376 GM16492-PA 9..376 12..376 1116 54.2 Plus
Dsec\GM24109-PA 376 GM24109-PA 9..376 12..376 1106 53.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18855-PA 376 GD18855-PA 1..376 1..376 2006 99.7 Plus
Dsim\GD18909-PA 376 GD18909-PA 9..376 12..376 1119 54.6 Plus
Dsim\Act88F-PA 376 GD19025-PA 9..376 12..376 1117 54.9 Plus
Dsim\GD16764-PA 376 GD16764-PA 9..376 12..376 1116 54.2 Plus
Dsim\GD15015-PA 376 GD15015-PA 9..376 12..376 1116 54.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23183-PA 376 GJ23183-PA 1..376 1..376 1981 98.1 Plus
Dvir\ActE2-PA 376 GJ22881-PA 9..376 12..376 1120 54.9 Plus
Dvir\ActE1-PA 376 GJ10425-PA 9..376 12..376 1119 54.6 Plus
Dvir\GJ18395-PA 376 GJ18395-PA 9..376 12..376 1119 54.5 Plus
Dvir\GJ14747-PA 376 GJ14747-PA 9..376 12..376 1116 54.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13729-PA 376 GK13729-PA 1..376 1..376 1988 98.4 Plus
Dwil\GK13943-PA 376 GK13943-PA 9..376 12..376 1119 54.6 Plus
Dwil\GK11462-PA 376 GK11462-PA 9..376 12..376 1117 54.9 Plus
Dwil\GK20124-PA 376 GK20124-PA 9..376 12..376 1116 54.2 Plus
Dwil\GK10683-PA 376 GK10683-PA 9..376 12..376 1116 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26215-PA 376 GE26215-PA 1..376 1..376 2003 99.5 Plus
Dyak\GE26273-PA 376 GE26273-PA 9..376 12..376 1119 54.6 Plus
Dyak\GE24312-PA 376 GE24312-PA 9..376 12..376 1117 54.9 Plus
Dyak\Act57B-PA 376 GE17558-PA 9..376 12..376 1116 54.2 Plus
Dyak\GE19434-PA 376 GE19434-PA 9..376 12..376 1116 54.2 Plus