BDGP Sequence Production Resources |
Search the DGRC for RH04903
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 49 |
Well: | 3 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL7-RA |
Protein status: | RH04903.pep: gold |
Preliminary Size: | 960 |
Sequenced Size: | 909 |
Gene | Date | Evidence |
---|---|---|
CG4897 | 2002-01-01 | Sim4 clustering to Release 2 |
CG4897 | 2002-02-22 | Blastp of sequenced clone |
CG4897 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL7 | 2008-04-29 | Release 5.5 accounting |
RpL7 | 2008-08-15 | Release 5.9 accounting |
RpL7 | 2008-12-18 | 5.12 accounting |
909 bp (909 high quality bases) assembled on 2002-02-22
GenBank Submission: AY089648
> RH04903.complete GCTTTCTTTCCCTTTCTTTTACCAGCGTGTGCAGTGACTAGTAAAAGATG CCTGCTCCGGTCGTCAAGAAGCCAGCAGCGAAAAAGCTGCCCGCCGTGCC GGAATCGAAGCTGAAGTTCAGCAAGAAACAAATCTCCAAGCGAGTCGCCG AGTCGAAACGTCGCCTGAAGAAGGCCGCCGTGATTGCCCTGCGCAAGAAG GAGAACCTGGTCCGCGCCGAGAAGTACCAGAATGAGTACATCAAGGCGGA ACAGCGCGAGATCAAGCTGCGTCGCTTGGCCAAGAAGCGCAACCAGTTCT ACGTGCCCGCCGAGGCCAAATTGGCCTTTGTCGTCCGTATCCGCGGTATC AACAAGGTGGCTCCCAAGGTCCGCAAGGTTCTGCAGCTGTTCCGTCTGAG GCAGATCAACAACGGTGTGTTCATCAAGCTGAACAAGGCCACCATCAACA TGCTGCGCATCGCCGAGCCCTACATCACCTGGGGCTATCCCAATCTGAAG TCCGTGCGGGAGCTGATCTACAAGCGTGGATTCGTGAAGCATAACCGCCA GCGCGTGCCCATCACCGATAACTTCGTGATCGAGCGGAAGCTGCGTCAGG CGCACCAAATTCAGTGCGTCGAGGATCTTGTCCATGAGATCTTCACCGTG GGGCCCAACTTCAAGTACGCCTCCAACTTCCTGTGGCCCTTCAAGCTAAA CACCCCCACCGGCGGCTGGCGCAAGAAGGCCAACCATTATGTCAACGGTG GTGACTTCGGCAACCGCGAGGACCAGATCAACCGTCTGCTGCGCAAGATG GTCTAAGGACTCCTTTTGATTTATGTGCTGAAACGACAACTGCAGCGGTT CGATGTAAACAGTGAGAGAAATAAAAGTTACTTTTATAAACCCAAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL7-RA | 1181 | RpL7-RA | 100..992 | 2..894 | 4465 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10200482..10201029 | 346..893 | 2740 | 100 | Plus |
chr2L | 23010047 | chr2L | 10200112..10200412 | 46..346 | 1505 | 100 | Plus |
chr2L | 23010047 | chr2L | 10199987..10200032 | 2..47 | 230 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10201598..10202146 | 346..894 | 2745 | 100 | Plus |
2L | 23513712 | 2L | 10201228..10201528 | 46..346 | 1505 | 100 | Plus |
2L | 23513712 | 2L | 10201103..10201148 | 2..47 | 230 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10199985..10200032 | 1..47 | 97 | -> | Plus |
chr2L | 10200114..10200412 | 48..346 | 100 | -> | Plus |
chr2L | 10200483..10201029 | 347..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..759 | 48..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..759 | 48..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..759 | 48..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..759 | 48..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..759 | 48..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..894 | 1..893 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..894 | 1..893 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 2..895 | 1..893 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 1..894 | 1..893 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL7-RA | 2..895 | 1..893 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10201101..10201148 | 1..47 | 97 | -> | Plus |
2L | 10201230..10201528 | 48..346 | 100 | -> | Plus |
2L | 10201599..10202145 | 347..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10201101..10201148 | 1..47 | 97 | -> | Plus |
2L | 10201230..10201528 | 48..346 | 100 | -> | Plus |
2L | 10201599..10202145 | 347..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10201101..10201148 | 1..47 | 97 | -> | Plus |
2L | 10201230..10201528 | 48..346 | 100 | -> | Plus |
2L | 10201599..10202145 | 347..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10201101..10201148 | 1..47 | 97 | -> | Plus |
arm_2L | 10201230..10201528 | 48..346 | 100 | -> | Plus |
arm_2L | 10201599..10202145 | 347..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10201230..10201528 | 48..346 | 100 | -> | Plus |
2L | 10201599..10202145 | 347..893 | 100 | Plus | |
2L | 10201101..10201148 | 1..47 | 97 | -> | Plus |
Translation from 47 to 805
> RH04903.pep MPAPVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRK KENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRG INKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNL KSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFT VGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRK MV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15749-PA | 252 | GF15749-PA | 1..252 | 1..252 | 1270 | 96.8 | Plus |
Dana\GF21557-PA | 257 | GF21557-PA | 10..257 | 13..252 | 340 | 33.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10089-PA | 252 | GG10089-PA | 1..252 | 1..252 | 1287 | 98.4 | Plus |
Dere\GG23760-PA | 257 | GG23760-PA | 10..257 | 13..252 | 341 | 32.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11082-PA | 252 | GH11082-PA | 17..252 | 17..252 | 1172 | 94.1 | Plus |
Dgri\GH11571-PA | 257 | GH11571-PA | 10..257 | 13..252 | 338 | 32.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL7-PB | 252 | CG4897-PB | 1..252 | 1..252 | 1294 | 100 | Plus |
RpL7-PA | 252 | CG4897-PA | 1..252 | 1..252 | 1294 | 100 | Plus |
RpL7-like-PC | 257 | CG5317-PC | 4..255 | 7..250 | 344 | 33.3 | Plus |
RpL7-like-PB | 257 | CG5317-PB | 4..255 | 7..250 | 344 | 33.3 | Plus |
RpL7-like-PA | 257 | CG5317-PA | 4..255 | 7..250 | 344 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17599-PA | 252 | GI17599-PA | 17..252 | 17..252 | 1185 | 96.2 | Plus |
Dmoj\GI17062-PA | 257 | GI17062-PA | 10..257 | 13..252 | 357 | 34.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16367-PA | 238 | GL16367-PA | 7..238 | 21..252 | 1163 | 95.7 | Plus |
Dper\GL18963-PA | 157 | GL18963-PA | 1..100 | 1..100 | 455 | 95 | Plus |
Dper\GL16173-PA | 279 | GL16173-PA | 10..236 | 13..232 | 302 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18510-PA | 252 | GA18510-PA | 1..252 | 1..252 | 1267 | 96.4 | Plus |
Dpse\GA18800-PA | 257 | GA18800-PA | 10..257 | 13..252 | 330 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17982-PA | 252 | GM17982-PA | 1..252 | 1..252 | 1296 | 99.2 | Plus |
Dsec\GM26715-PA | 257 | GM26715-PA | 10..257 | 13..252 | 343 | 32.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23662-PA | 252 | GD23662-PA | 1..252 | 1..252 | 1296 | 99.2 | Plus |
Dsim\GD23812-PA | 257 | GD23812-PA | 10..257 | 13..252 | 343 | 32.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17944-PA | 252 | GJ17944-PA | 17..252 | 17..252 | 1195 | 96.6 | Plus |
Dvir\GJ17314-PA | 257 | GJ17314-PA | 10..257 | 13..252 | 336 | 31.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18655-PA | 252 | GK18655-PA | 1..252 | 1..252 | 1271 | 96 | Plus |
Dwil\GK18411-PA | 252 | GK18411-PA | 1..252 | 1..252 | 1271 | 96 | Plus |
Dwil\GK21063-PA | 257 | GK21063-PA | 10..257 | 13..252 | 344 | 33.1 | Plus |
Translation from 47 to 805
> RH04903.hyp MPAPVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRK KENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRG INKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNL KSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFT VGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRK MV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL7-PB | 252 | CG4897-PB | 1..252 | 1..252 | 1294 | 100 | Plus |
RpL7-PA | 252 | CG4897-PA | 1..252 | 1..252 | 1294 | 100 | Plus |
RpL7-like-PC | 257 | CG5317-PC | 4..255 | 7..250 | 344 | 33.3 | Plus |
RpL7-like-PB | 257 | CG5317-PB | 4..255 | 7..250 | 344 | 33.3 | Plus |
RpL7-like-PA | 257 | CG5317-PA | 4..255 | 7..250 | 344 | 33.3 | Plus |