Clone RH04903 Report

Search the DGRC for RH04903

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:49
Well:3
Vector:pFlc-1
Associated Gene/TranscriptRpL7-RA
Protein status:RH04903.pep: gold
Preliminary Size:960
Sequenced Size:909

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4897 2002-01-01 Sim4 clustering to Release 2
CG4897 2002-02-22 Blastp of sequenced clone
CG4897 2003-01-01 Sim4 clustering to Release 3
RpL7 2008-04-29 Release 5.5 accounting
RpL7 2008-08-15 Release 5.9 accounting
RpL7 2008-12-18 5.12 accounting

Clone Sequence Records

RH04903.complete Sequence

909 bp (909 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089648

> RH04903.complete
GCTTTCTTTCCCTTTCTTTTACCAGCGTGTGCAGTGACTAGTAAAAGATG
CCTGCTCCGGTCGTCAAGAAGCCAGCAGCGAAAAAGCTGCCCGCCGTGCC
GGAATCGAAGCTGAAGTTCAGCAAGAAACAAATCTCCAAGCGAGTCGCCG
AGTCGAAACGTCGCCTGAAGAAGGCCGCCGTGATTGCCCTGCGCAAGAAG
GAGAACCTGGTCCGCGCCGAGAAGTACCAGAATGAGTACATCAAGGCGGA
ACAGCGCGAGATCAAGCTGCGTCGCTTGGCCAAGAAGCGCAACCAGTTCT
ACGTGCCCGCCGAGGCCAAATTGGCCTTTGTCGTCCGTATCCGCGGTATC
AACAAGGTGGCTCCCAAGGTCCGCAAGGTTCTGCAGCTGTTCCGTCTGAG
GCAGATCAACAACGGTGTGTTCATCAAGCTGAACAAGGCCACCATCAACA
TGCTGCGCATCGCCGAGCCCTACATCACCTGGGGCTATCCCAATCTGAAG
TCCGTGCGGGAGCTGATCTACAAGCGTGGATTCGTGAAGCATAACCGCCA
GCGCGTGCCCATCACCGATAACTTCGTGATCGAGCGGAAGCTGCGTCAGG
CGCACCAAATTCAGTGCGTCGAGGATCTTGTCCATGAGATCTTCACCGTG
GGGCCCAACTTCAAGTACGCCTCCAACTTCCTGTGGCCCTTCAAGCTAAA
CACCCCCACCGGCGGCTGGCGCAAGAAGGCCAACCATTATGTCAACGGTG
GTGACTTCGGCAACCGCGAGGACCAGATCAACCGTCTGCTGCGCAAGATG
GTCTAAGGACTCCTTTTGATTTATGTGCTGAAACGACAACTGCAGCGGTT
CGATGTAAACAGTGAGAGAAATAAAAGTTACTTTTATAAACCCAAAAAAA
AAAAAAAAA

RH04903.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
RpL7-RA 1181 RpL7-RA 100..992 2..894 4465 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10200482..10201029 346..893 2740 100 Plus
chr2L 23010047 chr2L 10200112..10200412 46..346 1505 100 Plus
chr2L 23010047 chr2L 10199987..10200032 2..47 230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10201598..10202146 346..894 2745 100 Plus
2L 23513712 2L 10201228..10201528 46..346 1505 100 Plus
2L 23513712 2L 10201103..10201148 2..47 230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10201598..10202146 346..894 2745 100 Plus
2L 23513712 2L 10201228..10201528 46..346 1505 100 Plus
2L 23513712 2L 10201103..10201148 2..47 230 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:59:15 has no hits.

RH04903.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:00:17 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10199985..10200032 1..47 97 -> Plus
chr2L 10200114..10200412 48..346 100 -> Plus
chr2L 10200483..10201029 347..893 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:24 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..759 48..806 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:37:21 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..759 48..806 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:37 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..759 48..806 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:14 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..759 48..806 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:02 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..759 48..806 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:02:37 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..894 1..893 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:37:21 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..894 1..893 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:37 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 2..895 1..893 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:14 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 1..894 1..893 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:02 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-RA 2..895 1..893 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:17 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10201101..10201148 1..47 97 -> Plus
2L 10201230..10201528 48..346 100 -> Plus
2L 10201599..10202145 347..893 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:17 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10201101..10201148 1..47 97 -> Plus
2L 10201230..10201528 48..346 100 -> Plus
2L 10201599..10202145 347..893 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:00:17 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10201101..10201148 1..47 97 -> Plus
2L 10201230..10201528 48..346 100 -> Plus
2L 10201599..10202145 347..893 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:37 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10201101..10201148 1..47 97 -> Plus
arm_2L 10201230..10201528 48..346 100 -> Plus
arm_2L 10201599..10202145 347..893 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:42:18 Download gff for RH04903.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10201230..10201528 48..346 100 -> Plus
2L 10201599..10202145 347..893 100   Plus
2L 10201101..10201148 1..47 97 -> Plus

RH04903.pep Sequence

Translation from 47 to 805

> RH04903.pep
MPAPVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRK
KENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRG
INKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNL
KSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFT
VGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRK
MV*

RH04903.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15749-PA 252 GF15749-PA 1..252 1..252 1270 96.8 Plus
Dana\GF21557-PA 257 GF21557-PA 10..257 13..252 340 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10089-PA 252 GG10089-PA 1..252 1..252 1287 98.4 Plus
Dere\GG23760-PA 257 GG23760-PA 10..257 13..252 341 32.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11082-PA 252 GH11082-PA 17..252 17..252 1172 94.1 Plus
Dgri\GH11571-PA 257 GH11571-PA 10..257 13..252 338 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpL7-PB 252 CG4897-PB 1..252 1..252 1294 100 Plus
RpL7-PA 252 CG4897-PA 1..252 1..252 1294 100 Plus
RpL7-like-PC 257 CG5317-PC 4..255 7..250 344 33.3 Plus
RpL7-like-PB 257 CG5317-PB 4..255 7..250 344 33.3 Plus
RpL7-like-PA 257 CG5317-PA 4..255 7..250 344 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17599-PA 252 GI17599-PA 17..252 17..252 1185 96.2 Plus
Dmoj\GI17062-PA 257 GI17062-PA 10..257 13..252 357 34.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16367-PA 238 GL16367-PA 7..238 21..252 1163 95.7 Plus
Dper\GL18963-PA 157 GL18963-PA 1..100 1..100 455 95 Plus
Dper\GL16173-PA 279 GL16173-PA 10..236 13..232 302 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18510-PA 252 GA18510-PA 1..252 1..252 1267 96.4 Plus
Dpse\GA18800-PA 257 GA18800-PA 10..257 13..252 330 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17982-PA 252 GM17982-PA 1..252 1..252 1296 99.2 Plus
Dsec\GM26715-PA 257 GM26715-PA 10..257 13..252 343 32.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23662-PA 252 GD23662-PA 1..252 1..252 1296 99.2 Plus
Dsim\GD23812-PA 257 GD23812-PA 10..257 13..252 343 32.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17944-PA 252 GJ17944-PA 17..252 17..252 1195 96.6 Plus
Dvir\GJ17314-PA 257 GJ17314-PA 10..257 13..252 336 31.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18655-PA 252 GK18655-PA 1..252 1..252 1271 96 Plus
Dwil\GK18411-PA 252 GK18411-PA 1..252 1..252 1271 96 Plus
Dwil\GK21063-PA 257 GK21063-PA 10..257 13..252 344 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL7-PA 252 GE18904-PA 1..252 1..252 1295 99.2 Plus
Dyak\GE18566-PA 257 GE18566-PA 10..257 13..252 337 32.5 Plus

RH04903.hyp Sequence

Translation from 47 to 805

> RH04903.hyp
MPAPVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRK
KENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRG
INKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNL
KSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFT
VGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRK
MV*

RH04903.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpL7-PB 252 CG4897-PB 1..252 1..252 1294 100 Plus
RpL7-PA 252 CG4897-PA 1..252 1..252 1294 100 Plus
RpL7-like-PC 257 CG5317-PC 4..255 7..250 344 33.3 Plus
RpL7-like-PB 257 CG5317-PB 4..255 7..250 344 33.3 Plus
RpL7-like-PA 257 CG5317-PA 4..255 7..250 344 33.3 Plus