Clone RH04924 Report

Search the DGRC for RH04924

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:49
Well:24
Vector:pFlc-1
Associated Gene/Transcriptse-RA
Protein status:RH04924.pep: gold
Preliminary Size:732
Sequenced Size:835

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6781 2001-12-13 Blastp of sequenced clone
CG6781 2002-01-01 Sim4 clustering to Release 2
CG6781 2003-01-01 Sim4 clustering to Release 3
se 2008-04-29 Release 5.5 accounting
se 2008-08-15 Release 5.9 accounting
se 2008-12-18 5.12 accounting

Clone Sequence Records

RH04924.complete Sequence

835 bp (835 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070667

> RH04924.complete
GACTTGCATCTCTGGACCCGAGCACGCACATCATGAGTAACGGCAGGCAT
TTGGCAAAAGGCTCACCCATGCCGGATGTTCCCGAAGATGGTATCCTTCG
CCTGTACTCGATGCGCTTCTGCCCATTTGCCCAACGGGTGCATCTGGTCC
TGGACGCCAAGCAGATCCCGTATCACAGCATCTACATTAATCTCACAGAC
AAGCCGGAGTGGCTGCTGGAGAAGAATCCACAGGGCAAGGTGCCGGCTCT
AGAAATCGTGCGAGAACCTGGACCACCTGTGCTCACAGAGTCGCTACTGA
TTTGTGAATATCTGGACGAGCAGTATCCATTGCGACCACTCTATCCACGT
GATCCGCTGAAGAAAGTGCAGGACAAGTTACTAATCGAGCGATTTAGAGC
GGTGTTAGGTGCCTTCTTCAAGGCATCCGATGGCGGTGATCTGGAGCCCT
TCTGGAGCGGCCTGGACATCTACGAAAGGGAGCTGGCTCGACGTGGTACG
GAATTCTTTGGTGGCGAGCAGACGGGCATTCTGGACTATATGATTTGGCC
CTGGTGTGAGCGCCTCGAGCTCCTTAAGTTGCAGCGTGGAGAGGATTATA
ACTACGATCAGAGTCGCTTCCCCCAGCTGACCCTTTGGCTGGAACGCATG
AAACGAGATCCGGCTGTGATGGCCTTCTACATGGAGGCCGAGGTTCAGGC
GGAGTTCCTGCGTACACGGAGCCTGGGTCGACCCAATTACAATCTGCTGG
TCAAGGATGCCTGATGCACTTGGTTTATTGAATTTTTCGCATGGAATGAA
TAAAACATAAATGCAGTCCAAAAAAAAAAAAAAAA

RH04924.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
se-RA 910 se-RA 86..904 2..820 4095 100 Plus
CG6673-RA 1086 CG6673-RA 1003..1086 820..737 420 100 Minus
CG6776-RA 1085 CG6776-RA 231..403 48..220 280 77.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8512645..8513215 59..629 2780 99.1 Plus
chr3L 24539361 chr3L 8513272..8513463 629..819 895 99 Plus
chr3L 24539361 chr3L 8512533..8512592 2..61 300 100 Plus
chr3L 24539361 chr3L 8511511..8511644 87..220 250 79.1 Plus
chr3L 24539361 chr3L 8516540..8516650 212..102 195 78.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8520672..8521242 59..629 2855 100 Plus
3L 28110227 3L 8521299..8521490 629..820 960 100 Plus
3L 28110227 3L 8520559..8520618 2..61 300 100 Plus
3L 28110227 3L 8519538..8519671 87..220 250 79.1 Plus
3L 28110227 3L 8524566..8524676 212..102 195 78.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8513772..8514342 59..629 2855 100 Plus
3L 28103327 3L 8514399..8514590 629..820 960 100 Plus
3L 28103327 3L 8513659..8513718 2..61 300 100 Plus
3L 28103327 3L 8512638..8512771 87..220 250 79.1 Plus
3L 28103327 3L 8517666..8517776 212..102 195 78.3 Minus
Blast to na_te.dros performed on 2019-03-16 09:29:31 has no hits.

RH04924.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:30:35 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8512532..8512591 1..60 98 -> Plus
chr3L 8512647..8513215 61..629 99 -> Plus
chr3L 8513273..8513463 630..819 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:27 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 1..732 33..764 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:00 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 1..732 33..764 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:01:50 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 1..732 33..764 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:06 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 1..732 33..764 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:17 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 1..732 33..764 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:31 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 7..825 1..819 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:00 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 7..825 1..819 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:01:50 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 7..825 1..819 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:06 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 7..825 1..819 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:17 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
se-RA 7..825 1..819 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:35 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8520558..8520617 1..60 98 -> Plus
3L 8520674..8521242 61..629 100 -> Plus
3L 8521300..8521489 630..819 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:35 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8520558..8520617 1..60 98 -> Plus
3L 8520674..8521242 61..629 100 -> Plus
3L 8521300..8521489 630..819 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:30:35 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8520558..8520617 1..60 98 -> Plus
3L 8520674..8521242 61..629 100 -> Plus
3L 8521300..8521489 630..819 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:01:50 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8513658..8513717 1..60 98 -> Plus
arm_3L 8513774..8514342 61..629 100 -> Plus
arm_3L 8514400..8514589 630..819 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:14 Download gff for RH04924.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8513774..8514342 61..629 100 -> Plus
3L 8514400..8514589 630..819 100   Plus
3L 8513658..8513717 1..60 98 -> Plus

RH04924.hyp Sequence

Translation from 2 to 763

> RH04924.hyp
LASLDPSTHIMSNGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVL
DAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESLLI
CEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPF
WSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYN
YDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLV
KDA*

RH04924.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
se-PA 243 CG6781-PA 1..243 11..253 1300 100 Plus
GstO3-PA 241 CG6776-PA 1..240 11..249 775 57.1 Plus
GstO1-PA 254 CG6662-PA 1..248 11..253 692 52.8 Plus
GstO2-PB 250 CG6673-PB 6..245 15..248 620 46.7 Plus
GstO2-PA 251 CG6673-PA 6..248 15..251 575 43.6 Plus

RH04924.pep Sequence

Translation from 32 to 763

> RH04924.pep
MSNGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSI
YINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPL
RPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPFWSGLDIYERE
LARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLT
LWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLVKDA*

RH04924.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24331-PA 243 GF24331-PA 1..243 1..243 1194 91.4 Plus
Dana\GF24330-PA 243 GF24330-PA 1..241 1..240 724 54.4 Plus
Dana\GF10159-PA 252 GF10159-PA 1..246 1..243 702 55.2 Plus
Dana\GF10160-PA 250 GF10160-PA 7..245 6..238 622 46.9 Plus
Dana\GF10161-PA 223 GF10161-PA 1..221 27..242 498 42.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14321-PA 243 GG14321-PA 1..243 1..243 1237 95.9 Plus
Dere\GG14320-PA 241 GG14320-PA 1..241 1..240 754 55.6 Plus
Dere\GG15073-PA 254 GG15073-PA 1..248 1..243 684 51.6 Plus
Dere\GG15074-PA 250 GG15074-PA 6..245 5..238 613 46.2 Plus
Dere\GG15075-PA 248 GG15075-PA 5..245 7..241 580 45.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15265-PA 243 GH15265-PA 1..243 1..243 1195 91.8 Plus
Dgri\GH15264-PA 241 GH15264-PA 1..241 1..240 725 54.4 Plus
Dgri\GH16193-PA 249 GH16193-PA 6..244 5..238 620 48.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
se-PA 243 CG6781-PA 1..243 1..243 1300 100 Plus
GstO3-PA 241 CG6776-PA 1..240 1..239 775 57.1 Plus
GstO1-PA 254 CG6662-PA 1..248 1..243 692 52.8 Plus
GstO2-PB 250 CG6673-PB 6..245 5..238 620 46.7 Plus
GstO2-PA 251 CG6673-PA 6..248 5..241 575 43.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11974-PA 243 GI11974-PA 1..243 1..243 1179 91.4 Plus
Dmoj\GI11973-PA 241 GI11973-PA 1..241 1..240 683 51.5 Plus
Dmoj\GI13342-PA 251 GI13342-PA 1..243 1..238 638 49.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15504-PA 243 GL15504-PA 1..243 1..243 1165 88.1 Plus
Dper\GL15503-PA 241 GL15503-PA 1..241 1..240 694 53.1 Plus
Dper\GL15565-PA 253 GL15565-PA 1..247 1..243 671 51.4 Plus
Dper\GL15566-PA 250 GL15566-PA 6..245 5..238 633 49.2 Plus
Dper\GL15567-PA 246 GL15567-PA 5..245 7..241 617 49.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19859-PA 243 GA19859-PA 1..243 1..243 1161 87.7 Plus
Dpse\GA23844-PA 241 GA23844-PA 1..241 1..240 687 52.7 Plus
Dpse\GA19760-PA 243 GA19760-PA 1..243 1..239 665 51.4 Plus
Dpse\GA19769-PA 250 GA19769-PA 6..245 5..238 637 49.6 Plus
Dpse\GA23449-PA 246 GA23449-PA 5..245 7..241 614 48.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25062-PA 204 GM25062-PA 1..204 1..243 992 82.7 Plus
Dsec\GM25061-PA 241 GM25061-PA 1..241 1..240 752 55.2 Plus
Dsec\GM24930-PA 254 GM24930-PA 1..248 1..243 704 53.2 Plus
Dsec\GM24931-PA 250 GM24931-PA 6..245 5..238 614 46.7 Plus
Dsec\GM24932-PA 224 GM24932-PA 1..221 27..241 513 43.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14100-PA 243 GD14100-PA 1..243 1..243 1262 98.4 Plus
Dsim\GD14099-PA 241 GD14099-PA 1..241 1..240 725 53.9 Plus
Dsim\GD12978-PA 254 GD12978-PA 1..248 1..243 702 53.2 Plus
Dsim\GD12979-PA 250 GD12979-PA 6..245 5..238 611 46.7 Plus
Dsim\GD12980-PA 212 GD12980-PA 1..209 39..241 462 42.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12199-PA 243 GJ12199-PA 1..243 1..243 1172 90.5 Plus
Dvir\GJ12198-PA 241 GJ12198-PA 1..241 1..240 724 54.8 Plus
Dvir\GJ13170-PA 249 GJ13170-PA 6..244 5..238 644 49 Plus
Dvir\GJ13171-PA 222 GJ13171-PA 1..222 27..242 576 49.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20355-PA 243 GK20355-PA 1..243 1..243 1168 90.5 Plus
Dwil\GK20538-PA 259 GK20538-PA 1..253 1..243 684 52.4 Plus
Dwil\GK20354-PA 238 GK20354-PA 9..233 6..229 639 52 Plus
Dwil\GK20539-PA 251 GK20539-PA 7..246 5..238 611 47.9 Plus
Dwil\GK20540-PA 239 GK20540-PA 1..235 10..238 585 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20749-PA 243 GE20749-PA 1..243 1..243 1241 95.9 Plus
Dyak\GE20748-PA 241 GE20748-PA 1..241 1..240 766 56.8 Plus
Dyak\GE21296-PA 254 GE21296-PA 1..248 1..243 675 52.4 Plus
Dyak\GE21297-PA 250 GE21297-PA 6..245 5..238 617 47.1 Plus
Dyak\GE21298-PA 224 GE21298-PA 1..221 27..241 519 43.9 Plus