Clone RH05411 Report

Search the DGRC for RH05411

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:54
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG16712-RA
Protein status:RH05411.pep: gold
Sequenced Size:366

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16712 2001-12-13 Blastp of sequenced clone
CG16712 2002-01-01 Sim4 clustering to Release 2
CG16712 2003-01-01 Sim4 clustering to Release 3
CG16712 2008-04-29 Release 5.5 accounting
CG16712 2008-08-15 Release 5.9 accounting
CG16712 2008-12-18 5.12 accounting

Clone Sequence Records

RH05411.complete Sequence

366 bp (366 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070668

> RH05411.complete
GATTAGTCGTTCCACGGAAGCTGGGAGATATACATAGTTTTCAAAATCGC
AATCAGTATGAAATTCATTGCTGCCGTCTGTTTGATGTTCGCCCTGGTGG
CTGTGGCCCTCGGCCTCAAGGATCCTATCTGTGGACTGCCCGCTGGTATT
GATGGCAATGGTCTCATCAAGTGTGCCGCTTTTATACCCAGCTTCAGTTA
TCATCCCGAAACCAATTCGTGTGAAAAGTTCATCTACGGCGGATGCGGCG
GCAATGAGAACCGATTTGGAACCCAGGAGCTCTGCGAACAAAAGTGCAAG
GAATAAATTTGACCTCTATGCTCTACAAAATATTCAATAAATGATTTTCG
AAAAAAAAAAAAAAAA

RH05411.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG16712-RA 662 CG16712-RA 206..559 2..355 1755 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3695758..3695983 350..125 1130 100 Minus
chr2L 23010047 chr2L 3696044..3696166 124..2 615 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3696241..3696471 355..125 1140 99.6 Minus
2L 23513712 2L 3696532..3696654 124..2 615 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3696241..3696471 355..125 1140 99.5 Minus
2L 23513712 2L 3696532..3696654 124..2 615 100 Minus
Blast to na_te.dros performed 2019-03-16 14:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 1481..1516 312..347 108 77.8 Plus
X-element 4740 X-element ROXELEMENT 4740bp 515..591 242..313 103 63.6 Plus

RH05411.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:18:45 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3695758..3695983 125..350 100 <- Minus
chr2L 3696044..3696166 1..124 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:30 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 1..249 58..306 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:59 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 1..249 58..306 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:42:44 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 1..249 58..306 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:05 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 1..249 58..306 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:03 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 1..249 58..306 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:29 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 7..356 1..350 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:58 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 7..356 1..350 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:42:44 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 4..353 1..350 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:05 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 7..356 1..350 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:03 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
CG16712-RA 4..353 1..350 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:45 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3696246..3696471 125..350 100 <- Minus
2L 3696532..3696654 1..124 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:45 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3696246..3696471 125..350 100 <- Minus
2L 3696532..3696654 1..124 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:45 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3696246..3696471 125..350 100 <- Minus
2L 3696532..3696654 1..124 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:42:44 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3696246..3696471 125..350 100 <- Minus
arm_2L 3696532..3696654 1..124 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:13 Download gff for RH05411.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3696246..3696471 125..350 100 <- Minus
2L 3696532..3696654 1..124 99   Minus

RH05411.pep Sequence

Translation from 57 to 305

> RH05411.pep
MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHP
ETNSCEKFIYGGCGGNENRFGTQELCEQKCKE*

RH05411.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14654-PA 82 GF14654-PA 1..82 1..82 325 72 Plus
Dana\GF15247-PA 82 GF15247-PA 1..82 1..82 234 53.7 Plus
Dana\GF19682-PA 82 GF19682-PA 1..82 1..82 207 46.3 Plus
Dana\GF14655-PA 81 GF14655-PA 1..79 1..80 193 45 Plus
Dana\GF14657-PA 82 GF14657-PA 1..78 1..81 163 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24412-PA 82 GG24412-PA 1..82 1..82 364 84.1 Plus
Dere\GG24409-PA 82 GG24409-PA 1..82 1..82 364 84.1 Plus
Dere\GG24415-PA 82 GG24415-PA 1..82 1..82 308 69.5 Plus
Dere\GG24414-PA 82 GG24414-PA 1..82 1..82 307 72 Plus
Dere\GG24413-PA 82 GG24413-PA 1..80 1..80 231 53.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13180-PA 81 GH13180-PA 1..80 1..80 305 63.7 Plus
Dgri\GH25268-PA 83 GH25268-PA 1..81 1..80 185 43.2 Plus
Dgri\GH22481-PA 83 GH22481-PA 1..81 1..80 182 43.2 Plus
Dgri\GH13181-PA 83 GH13181-PA 1..81 1..80 182 43.2 Plus
Dgri\GH13184-PA 94 GH13184-PA 1..76 1..75 159 42.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
IM33-PB 82 CG16712-PB 1..82 1..82 448 100 Plus
IM33-PA 82 CG16712-PA 1..82 1..82 448 100 Plus
CG16713-PA 82 CG16713-PA 1..80 1..80 253 56.2 Plus
CG43165-PA 95 CG43165-PA 1..81 1..81 244 53.1 Plus
Acp24A4-PC 78 CG31779-PC 1..78 1..82 184 46.3 Plus
Acp24A4-PB 78 CG31779-PB 1..78 1..82 184 46.3 Plus
CG42464-PA 87 CG42464-PA 2..81 3..81 174 46.2 Plus
CG16704-PB 79 CG16704-PB 1..78 1..81 166 42.7 Plus
CG16704-PA 79 CG16704-PA 1..78 1..81 166 42.7 Plus
CG3513-PA 88 CG3513-PA 1..88 1..82 158 37.5 Plus
CG2816-PB 84 CG2816-PB 39..83 38..82 146 48.9 Plus
Ppn-PF 2776 CG33103-PF 1848..1899 24..80 142 43.9 Plus
Ppn-PG 2841 CG33103-PG 1791..1842 24..80 142 43.9 Plus
Ppn-PE 2898 CG33103-PE 1848..1899 24..80 142 43.9 Plus
CG3604-PB 132 CG3604-PB 63..105 38..80 137 48.8 Plus
CG3604-PA 132 CG3604-PA 63..105 38..80 137 48.8 Plus
Sfp24Bd-PB 111 CG42463-PB 1..78 1..82 133 35.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17757-PA 82 GI17757-PA 1..82 1..82 312 65.9 Plus
Dmoj\GI23877-PA 82 GI23877-PA 1..82 1..82 241 52.4 Plus
Dmoj\GI17759-PA 82 GI17759-PA 18..82 18..82 217 61.5 Plus
Dmoj\GI17758-PA 82 GI17758-PA 1..82 1..82 202 42.7 Plus
Dmoj\GI17763-PA 79 GI17763-PA 16..78 15..81 142 46.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19459-PA 82 GL19459-PA 1..82 1..82 293 62.2 Plus
Dper\GL19427-PA 78 GL19427-PA 1..78 1..82 224 52.4 Plus
Dper\GL19460-PA 80 GL19460-PA 1..80 1..82 215 52.4 Plus
Dper\GL19462-PA 82 GL19462-PA 1..82 1..82 201 50 Plus
Dper\GL19512-PA 92 GL19512-PA 1..84 1..82 173 44 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14098-PA 82 GA14098-PA 1..82 1..82 302 64.6 Plus
Dpse\GA25956-PA 78 GA25956-PA 1..78 1..82 219 52.4 Plus
Dpse\GA25969-PA 80 GA25969-PA 1..80 1..82 210 51.2 Plus
Dpse\GA25971-PA 82 GA25971-PA 1..82 1..82 206 51.2 Plus
Dpse\GA25987-PA 92 GA25987-PA 1..84 1..82 170 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18127-PA 82 GM18127-PA 1..82 1..82 409 92.7 Plus
Dsec\GM18128-PA 82 GM18128-PA 1..82 1..82 243 54.9 Plus
Dsec\GM18131-PA 78 GM18131-PA 1..77 1..81 153 38.3 Plus
Dsec\GM18130-PA 88 GM18130-PA 1..88 1..82 150 36.4 Plus
Dsec\GM18428-PA 91 GM18428-PA 46..90 38..82 133 48.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22734-PA 82 GD22734-PA 1..82 1..82 408 92.7 Plus
Dsim\GD22735-PA 82 GD22735-PA 1..82 1..82 243 54.9 Plus
Dsim\Acp24A4-PA 78 GD22736-PA 1..78 1..82 161 45.1 Plus
Dsim\GD22737-PA 88 GD22737-PA 1..88 1..82 150 36.4 Plus
Dsim\GD22738-PA 86 GD22738-PA 1..78 1..81 136 39 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17585-PA 82 GJ17585-PA 1..82 1..82 324 72 Plus
Dvir\GJ17586-PA 82 GJ17586-PA 1..82 1..82 215 47.6 Plus
Dvir\GJ21125-PA 80 GJ21125-PA 1..80 1..82 178 45.1 Plus
Dvir\GJ16348-PA 86 GJ16348-PA 43..86 39..82 137 50 Plus
Dvir\GJ16350-PA 79 GJ16350-PA 21..78 20..81 137 48.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15469-PA 80 GK15469-PA 1..78 1..80 225 55 Plus
Dwil\GK18965-PA 79 GK18965-PA 1..78 1..81 157 39 Plus
Dwil\GK15471-PA 90 GK15471-PA 38..90 29..82 156 51.9 Plus
Dwil\GK15472-PA 79 GK15472-PA 1..78 1..81 142 41.5 Plus
Dwil\GK14644-PA 82 GK14644-PA 37..81 38..82 136 48.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14815-PA 82 GE14815-PA 1..82 1..82 347 86.6 Plus
Dyak\GE14816-PA 82 GE14816-PA 1..80 1..80 228 52.5 Plus
Dyak\GE17972-PA 84 GE17972-PA 1..84 1..82 199 53.6 Plus
Dyak\GE14817-PA 106 GE14817-PA 19..106 1..82 145 34.1 Plus
Dyak\GE18250-PA 84 GE18250-PA 39..83 38..82 138 51.1 Plus

RH05411.hyp Sequence

Translation from 57 to 305

> RH05411.hyp
MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHP
ETNSCEKFIYGGCGGNENRFGTQELCEQKCKE*

RH05411.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG16712-PB 82 CG16712-PB 1..82 1..82 448 100 Plus
CG16712-PA 82 CG16712-PA 1..82 1..82 448 100 Plus
CG16713-PA 82 CG16713-PA 1..80 1..80 253 56.2 Plus
CG43165-PA 95 CG43165-PA 1..81 1..81 244 53.1 Plus
Acp24A4-PC 78 CG31779-PC 1..78 1..82 184 46.3 Plus