Clone RH05486 Report

Search the DGRC for RH05486

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:54
Well:86
Vector:pFlc-1
Associated Gene/TranscriptCG3699-RA
Protein status:RH05486.pep: gold
Sequenced Size:855

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3699 2003-01-01 Sim4 clustering to Release 3
CG3699 2008-04-29 Release 5.5 accounting
CG3699 2008-08-15 Release 5.9 accounting
CG3699 2008-12-18 5.12 accounting

Clone Sequence Records

RH05486.complete Sequence

855 bp (855 high quality bases) assembled on 2004-12-16

GenBank Submission: BT021238

> RH05486.complete
GCCAGTGTTTCAATATGAGTCTCAGCAACAAGGTGGTGATCGTGACGGGA
GCTAGCAGCGGAATTGGTGCCGCCATCGCCCAAGTTCTTGCTCGCGAAGG
TGCCACTTTGGCGCTGGTGGGTCGCAATGTGGCCAATCTGGAGGCCACGA
AGAAGAGCCTGAAGGGCACGCAGGCAGAAATCGTGGTGGCCGATGTGACC
AAGGATGCGGACGCGATTGTCCAGCAAACGTTGGCCAAGTTCGGACGCAT
CGACGTGCTTGTCAACAATGCCGGCATTCTGGGCAAGGGTGGCCTCATCG
ATCTGGACATCGAGGAATTCGACGCGGTGCTCAATACCAATCTGCGTGGT
GTCATTCTGTTGACCAAGGCGGTGCTCCCGCACCTCCTGAAGACCAAGGG
AGCCGTGGTCAACGTGAGCAGCTGTGCCGGCATTCGTCCCTTCGCCGGAG
CACTGAGCTATGGAGTTTCGAAGGCCGCCCTCGATCAGTTCACCAAGATT
GTGGCCCTCGAAATGGCGCCTCAGGGTGTGCGCGTGAACTCGGTGAATCC
CGGCTTCGTGGTGACCAACATCCATCGGAACATTGGCATCGTCGACGAGG
AGTACAACGGAATGCTCCAGCGGGCCATCAATTCGCATCCCATGGGCCGT
GTAGGCGACGTCACCGAAGTGGCCGAGGCAGTGGCCTTTTTGGCCAGCTC
CAAGGCAAGTTTCACCACCGGCGCCCTCTTCCCCATCGATGGTGGCAAGC
ACAATCTGACGCCTCGTTAAGCGTGTTCCCCGTAATTACGTTTCCTCCAT
CCTTTTTTTTTTCAATAAATAAGTAGTAACCACAACGAAAAAAAAAAAAA
AAAAA

RH05486.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3699-RA 845 CG3699-RA 1..845 2..846 4180 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 840634..841467 835..2 4155 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 946653..947497 846..2 4180 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 954751..955595 846..2 4180 99.6 Minus
Blast to na_te.dros performed on 2019-03-15 16:41:25 has no hits.

RH05486.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:42:32 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 840632..841467 1..837 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:31 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..756 15..770 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:56 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..756 15..770 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:07:46 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..756 15..770 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:54 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..756 15..770 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:11 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..756 15..770 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:23:03 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..823 15..837 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:56 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..823 15..837 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:46 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 3..839 1..837 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:54 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 1..823 15..837 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:11 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
CG3699-RA 3..839 1..837 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:32 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
X 946662..947497 1..837 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:32 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
X 946662..947497 1..837 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:32 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
X 946662..947497 1..837 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:46 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 840695..841530 1..837 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:17 Download gff for RH05486.complete
Subject Subject Range Query Range Percent Splice Strand
X 954760..955595 1..837 99   Minus

RH05486.pep Sequence

Translation from 2 to 769

> RH05486.pep
QCFNMSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATK
KSLKGTQAEIVVADVTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLID
LDIEEFDAVLNTNLRGVILLTKAVLPHLLKTKGAVVNVSSCAGIRPFAGA
LSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGIVDEE
YNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKH
NLTPR*

RH05486.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22046-PA 251 GF22046-PA 1..251 5..255 1210 93.6 Plus
Dana\GF16339-PA 257 GF16339-PA 3..257 2..255 671 53.7 Plus
Dana\GF18656-PA 256 GF18656-PA 1..256 5..255 656 51.2 Plus
Dana\GF16338-PA 257 GF16338-PA 3..257 6..255 646 52.5 Plus
Dana\GF18657-PA 264 GF18657-PA 9..263 5..254 504 44.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12728-PA 251 GG12728-PA 1..251 5..255 1253 97.2 Plus
Dere\GG12970-PA 257 GG12970-PA 3..257 6..255 663 54.1 Plus
Dere\GG12965-PA 257 GG12965-PA 3..257 6..255 654 53.3 Plus
Dere\GG10914-PA 256 GG10914-PA 1..256 5..255 651 51.2 Plus
Dere\GG10919-PA 264 GG10919-PA 9..264 5..255 461 44.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22973-PA 257 GH22973-PA 3..257 6..255 660 53.3 Plus
Dgri\GH22984-PA 257 GH22984-PA 3..257 6..255 626 51.8 Plus
Dgri\GH17517-PA 257 GH17517-PA 1..257 5..255 596 45.5 Plus
Dgri\GH17658-PA 242 GH17658-PA 5..238 7..248 356 38.4 Plus
Dgri\GH15276-PA 325 GH15276-PA 77..320 7..248 332 34.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3699-PA 251 CG3699-PA 1..251 5..255 1230 100 Plus
CG12171-PA 257 CG12171-PA 3..257 6..255 651 53.7 Plus
CG31549-PB 257 CG31549-PB 3..257 6..255 642 53.3 Plus
CG31549-PA 257 CG31549-PA 3..257 6..255 642 53.3 Plus
CG31548-PA 256 CG31548-PA 1..256 5..255 636 51.6 Plus
CG31546-PA 264 CG31546-PA 9..264 5..255 525 43.8 Plus
CG3603-PB 249 CG3603-PB 6..247 7..248 341 33.1 Plus
CG3603-PA 249 CG3603-PA 6..247 7..248 341 33.1 Plus
CG7322-PC 242 CG7322-PC 5..238 7..248 339 37.2 Plus
CG7322-PB 242 CG7322-PB 5..238 7..248 339 37.2 Plus
CG7322-PA 242 CG7322-PA 5..238 7..248 339 37.2 Plus
CG10672-PA 317 CG10672-PA 69..312 7..248 328 33.1 Plus
CG7601-PA 326 CG7601-PA 45..246 1..193 239 30.2 Plus
CG6012-PA 308 CG6012-PA 54..238 14..191 238 34.4 Plus
CG10962-PB 249 CG10962-PB 6..202 9..190 227 33.5 Plus
scu-PA 255 CG7113-PA 2..249 7..247 219 30.5 Plus
CG40485-PC 247 CG40485-PC 6..229 9..233 217 29.5 Plus
CG40485-PB 247 CG40485-PB 6..229 9..233 217 29.5 Plus
CG31809-PC 316 CG31809-PC 52..236 13..191 217 32.3 Plus
CG31809-PB 316 CG31809-PB 52..236 13..191 217 32.3 Plus
CG31810-PA 324 CG31810-PA 60..244 13..191 217 32.3 Plus
CG13284-PE 325 CG13284-PE 60..245 13..191 217 32.4 Plus
CG13284-PA 325 CG13284-PA 60..245 13..191 217 32.4 Plus
CG13284-PC 338 CG13284-PC 73..258 13..191 217 32.4 Plus
CG13284-PD 339 CG13284-PD 74..259 13..191 217 32.4 Plus
CG13284-PB 339 CG13284-PB 74..259 13..191 217 32.4 Plus
spidey-PA 321 CG1444-PA 47..245 4..192 209 30.5 Plus
CG5590-PA 412 CG5590-PA 7..197 7..183 209 30.4 Plus
CG13833-PA 321 CG13833-PA 49..241 6..189 203 29 Plus
antdh-PA 250 CG1386-PA 6..203 9..190 201 32.7 Plus
CG40486-PC 247 CG40486-PC 6..203 9..190 198 30.7 Plus
CG40486-PB 247 CG40486-PB 6..203 9..190 198 30.7 Plus
Pdh-PD 260 CG4899-PD 1..191 5..193 198 33 Plus
Pdh-PB 277 CG4899-PB 18..208 5..193 198 33 Plus
Mfe2-PB 598 CG3415-PB 13..197 10..183 195 30 Plus
Mfe2-PA 598 CG3415-PA 13..197 10..183 195 30 Plus
CG40485-PA 231 CG40485-PA 6..182 9..171 194 30.5 Plus
Pdh-PC 261 CG4899-PC 1..192 5..193 192 32.5 Plus
Pdh-PA 278 CG4899-PA 18..209 5..193 192 32.5 Plus
CG31937-PA 321 CG31937-PA 37..289 3..246 192 27.9 Plus
CG17121-PA 361 CG17121-PA 90..260 7..171 192 31.6 Plus
CG4842-PA 259 CG4842-PA 1..194 5..195 181 31.7 Plus
CG9360-PA 251 CG9360-PA 6..203 9..190 176 33.3 Plus
CG30491-PB 331 CG30491-PB 44..262 8..209 168 27.6 Plus
CG30491-PA 331 CG30491-PA 44..262 8..209 168 27.6 Plus
sro-PA 335 CG12068-PA 25..240 8..211 168 25.1 Plus
Ldsdh1-PA 320 CG2254-PA 56..251 7..193 167 28.6 Plus
CG7675-PD 336 CG7675-PD 43..255 1..194 166 30.7 Plus
CG7675-PB 336 CG7675-PB 43..255 1..194 166 30.7 Plus
CG2065-PB 300 CG2065-PB 13..215 8..193 165 28.8 Plus
CG2065-PA 300 CG2065-PA 13..215 8..193 165 28.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14997-PA 255 GI14997-PA 1..255 5..255 1047 80.4 Plus
Dmoj\GI22521-PA 256 GI22521-PA 1..256 5..255 635 49.6 Plus
Dmoj\GI10241-PA 257 GI10241-PA 3..257 6..255 632 51 Plus
Dmoj\GI10240-PA 257 GI10240-PA 3..257 6..255 585 52.5 Plus
Dmoj\GI21510-PA 242 GI21510-PA 5..238 7..248 343 38.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14417-PA 255 GL14417-PA 1..255 5..255 1177 90.2 Plus
Dper\GL24511-PA 257 GL24511-PA 3..257 2..255 665 52.9 Plus
Dper\GL23021-PA 256 GL23021-PA 1..256 5..255 663 52 Plus
Dper\GL24510-PA 257 GL24510-PA 4..257 7..255 629 52.4 Plus
Dper\GL21318-PA 350 GL21318-PA 113..346 7..248 358 38.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17622-PA 255 GA17622-PA 1..255 5..255 1177 90.2 Plus
Dpse\GA11451-PA 257 GA11451-PA 3..257 2..255 675 53.7 Plus
Dpse\GA16317-PA 256 GA16317-PA 1..256 5..255 663 52 Plus
Dpse\GA27306-PA 257 GA27306-PA 4..257 7..255 630 52.4 Plus
Dpse\GA20258-PA 242 GA20258-PA 5..238 7..248 356 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19006-PA 251 GM19006-PA 1..251 5..255 1283 100 Plus
Dsec\GM10826-PA 257 GM10826-PA 3..257 6..255 664 53.7 Plus
Dsec\GM10606-PA 256 GM10606-PA 1..256 5..255 656 51.6 Plus
Dsec\GM10825-PA 257 GM10825-PA 3..257 6..255 652 53.7 Plus
Dsec\GM10607-PA 264 GM10607-PA 9..264 5..255 448 43.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16445-PA 251 GD16445-PA 1..251 5..255 1283 100 Plus
Dsim\GD19803-PA 257 GD19803-PA 3..257 6..255 658 53.7 Plus
Dsim\GD19595-PA 256 GD19595-PA 1..256 5..255 656 51.6 Plus
Dsim\GD19596-PA 264 GD19596-PA 9..264 5..255 448 43.8 Plus
Dsim\GD24467-PA 242 GD24467-PA 5..238 7..248 336 36.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15354-PA 255 GJ15354-PA 1..255 5..255 1040 79.6 Plus
Dvir\GJ10124-PA 255 GJ10124-PA 1..255 5..255 649 50.2 Plus
Dvir\GJ11045-PA 257 GJ11045-PA 3..257 6..255 649 52.9 Plus
Dvir\GJ10125-PA 255 GJ10125-PA 1..255 5..255 627 49.4 Plus
Dvir\GJ11044-PA 257 GJ11044-PA 3..257 6..255 581 52.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10169-PA 255 GK10169-PA 1..255 5..255 1085 84.3 Plus
Dwil\GK13928-PA 257 GK13928-PA 3..257 6..255 665 54.1 Plus
Dwil\GK13927-PA 257 GK13927-PA 3..257 6..255 654 52.5 Plus
Dwil\GK13365-PA 256 GK13365-PA 1..256 5..255 602 51.2 Plus
Dwil\GK20088-PA 242 GK20088-PA 5..238 7..248 380 39 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16554-PA 251 GE16554-PA 1..251 5..255 1244 97.6 Plus
Dyak\GE10146-PA 257 GE10146-PA 3..257 6..255 655 52.9 Plus
Dyak\GE24152-PA 256 GE24152-PA 1..256 5..255 650 50.8 Plus
Dyak\GE10147-PA 257 GE10147-PA 3..257 6..255 644 52.9 Plus
Dyak\GE24153-PA 264 GE24153-PA 9..264 5..255 454 44.5 Plus

RH05486.hyp Sequence

Translation from 2 to 769

> RH05486.hyp
QCFNMSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATK
KSLKGTQAEIVVADVTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLID
LDIEEFDAVLNTNLRGVILLTKAVLPHLLKTKGAVVNVSSCAGIRPFAGA
LSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIGIVDEE
YNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKH
NLTPR*

RH05486.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3699-PA 251 CG3699-PA 1..251 5..255 1230 100 Plus
CG12171-PA 257 CG12171-PA 3..257 6..255 651 53.7 Plus
CG31549-PB 257 CG31549-PB 3..257 6..255 642 53.3 Plus
CG31549-PA 257 CG31549-PA 3..257 6..255 642 53.3 Plus
CG31548-PA 256 CG31548-PA 1..256 5..255 636 51.6 Plus