Clone RH05746 Report

Search the DGRC for RH05746

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:57
Well:46
Vector:pFlc-1
Associated Gene/TranscriptCpr62Bb-RA
Protein status:RH05746.pep: gold
Preliminary Size:690
Sequenced Size:942

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13935 2002-01-01 Sim4 clustering to Release 2
CG13935 2003-01-01 Sim4 clustering to Release 3
CG13935 2003-08-11 Blastp of sequenced clone
Cpr62Bb 2008-04-29 Release 5.5 accounting
Cpr62Bb 2008-08-15 Release 5.9 accounting
Cpr62Bb 2008-12-18 5.12 accounting

Clone Sequence Records

RH05746.complete Sequence

942 bp (942 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010217

> RH05746.complete
GACAGTATTCCGGGCAACTTGGTGGTGTTTGTATCTAGTGCCGTTGAAAT
ACTCCAACAAATATTTTCCTCGTTTCAAATTCATTTGAAGCTATAAATAT
AAAACCCAAATACAAAATGGCAAACTTCGTGTGCTTCGTTATCCTTTCGT
TGGCTCTCTTCGCCAGTGTTGCTGTGGCGCGACCGGGATATGCCCTGGAT
TACTATGATCATCCAAAATATGCCTTTAACTACGGTGTGGCTGACCACAG
TACAGGAGATGTGAAGTCACAGCACGAGACGCGAGATGGAGATGTGGTCA
AGGGTCAGTACTCTCTGGTTGAGCCCGATGGCTCCATTCGCACTGTGGAC
TACACGGCGGACTCCATTCACGGCTTCAATGCCGTGGTGACCAAGTCGGG
ACCCACTGTGCACGCCCAGGCTGTGGTGGCCAGTCCCATTGTGGCCCACA
AGCCCGTCCTGACCCACTACGAGCCGCAGGTAGTGAAGCACGTGGCTCCA
GTGGCCCACGCTCCTCTGGTGGTGGCCTCCCCGGCGCCTTATGTGGCCAA
GCACTATGCTCCGGCGGCAGCTGCACCCATTCACTACGACTACGATGATG
GCTACTACAACCAGGGCCAGCAGTACGAGTACATCCCACAGTATGATCAG
TACAGCGGCCACTACGGCCACTATGCGAGTCCCTATGCGGGCCACTACTA
GGACGGACTCCGAGCTCCCACTTCTTAGTTACTTAAGCCCGCTTAGCTGT
ACGCCTCCACCTGGAACTTCATTGGATTCTCTCAGTGTAGCTTGCGAAGG
AATTTTGAGATCTACAAAAGGGAAACATCAAGGTTAATCTTATTTAAGTT
ATGCAACAAATTTGTAAAATAAAGATTCGAAAAAAAATTCAAGTGGAAGA
ACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RH05746.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr62Bb-RA 1037 Cpr62Bb-RA 65..969 2..906 4525 100 Plus
Cpr62Bb-RB 1053 Cpr62Bb-RB 209..1053 58..902 4225 100 Plus
Cpr66Cb-RA 1122 Cpr66Cb-RA 416..582 196..362 370 81.4 Plus
Cpr62Bb-RB 1053 Cpr62Bb-RB 65..120 2..57 280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1832166..1832525 902..543 1740 98.9 Minus
chr3L 24539361 chr3L 1833819..1834059 543..303 1190 99.6 Minus
chr3L 24539361 chr3L 1834397..1834546 207..58 735 99.3 Minus
chr3L 24539361 chr3L 1834111..1834213 309..207 500 99 Minus
chr3L 24539361 chr3L 8329958..8330108 212..362 320 80.8 Plus
chr3L 24539361 chr3L 1834633..1834688 57..2 280 100 Minus
chr3L 24539361 chr3L 1840511..1840696 413..228 270 76.3 Minus
chr3R 27901430 chr3R 15421989..15422115 388..262 215 78 Minus
chr2L 23010047 chr2L 11943908..11943990 276..358 205 83.1 Plus
chr3L 24539361 chr3L 19526614..19526665 281..332 185 90.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1832632..1832995 906..543 1820 100 Minus
3L 28110227 3L 1834289..1834529 543..303 1205 100 Minus
3L 28110227 3L 1834868..1835017 207..58 750 100 Minus
3L 28110227 3L 1834581..1834683 309..207 500 99 Minus
3L 28110227 3L 8337917..8338067 212..362 320 80.8 Plus
3L 28110227 3L 1835106..1835161 57..2 280 100 Minus
3L 28110227 3L 1840981..1841166 413..228 255 75.8 Minus
3R 32079331 3R 19598130..19598256 388..262 230 78.7 Minus
2L 23513712 2L 11945262..11945344 276..358 205 83.1 Plus
3L 28110227 3L 19537245..19537296 281..332 185 90.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1832632..1832995 906..543 1820 100 Minus
3L 28103327 3L 1834289..1834529 543..303 1205 100 Minus
3L 28103327 3L 1834868..1835017 207..58 750 100 Minus
3L 28103327 3L 1834581..1834683 309..207 500 99 Minus
3L 28103327 3L 8331017..8331167 212..362 320 80.7 Plus
3L 28103327 3L 1835106..1835161 57..2 280 100 Minus
3R 31820162 3R 19338961..19339087 388..262 230 78.7 Minus
3L 28103327 3L 1841039..1841139 355..255 220 81.1 Minus
2L 23513712 2L 11945262..11945344 276..358 205 83.1 Plus
Blast to na_te.dros performed 2019-03-16 23:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy 7469 gypsy DMGYPF1A 7469bp Derived from M12927 (g157583) (Rel. 44, Last updated, Version 6). 708..768 866..804 112 66.7 Minus

RH05746.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:42:59 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1833819..1834058 304..543 99 <- Minus
chr3L 1834117..1834213 207..303 100 <- Minus
chr3L 1834398..1834546 58..206 99 <- Minus
chr3L 1834633..1834688 1..57 98   Minus
chr3L 1832166..1832524 544..902 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:37 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RB 1..585 117..701 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:51:07 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RB 1..585 117..701 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:23:05 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RA 1..585 117..701 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:28 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RB 1..585 117..701 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:56:29 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RA 1..585 117..701 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:14:49 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RA 1..901 2..902 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:51:07 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RA 1..901 2..902 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:23:05 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RA 3..904 1..902 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:28 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RA 1..901 2..902 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:56:29 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr62Bb-RA 3..904 1..902 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:59 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1834869..1835017 58..206 100 <- Minus
3L 1835106..1835161 1..57 98   Minus
3L 1832636..1832994 544..902 100 <- Minus
3L 1834289..1834528 304..543 100 <- Minus
3L 1834587..1834683 207..303 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:59 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1834869..1835017 58..206 100 <- Minus
3L 1835106..1835161 1..57 98   Minus
3L 1832636..1832994 544..902 100 <- Minus
3L 1834289..1834528 304..543 100 <- Minus
3L 1834587..1834683 207..303 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:59 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1834869..1835017 58..206 100 <- Minus
3L 1835106..1835161 1..57 98   Minus
3L 1832636..1832994 544..902 100 <- Minus
3L 1834289..1834528 304..543 100 <- Minus
3L 1834587..1834683 207..303 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:23:05 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1832636..1832994 544..902 100 <- Minus
arm_3L 1834289..1834528 304..543 100 <- Minus
arm_3L 1834587..1834683 207..303 100 <- Minus
arm_3L 1834869..1835017 58..206 100 <- Minus
arm_3L 1835106..1835161 1..57 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:31 Download gff for RH05746.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1832636..1832994 544..902 100 <- Minus
3L 1834289..1834528 304..543 100 <- Minus
3L 1834587..1834683 207..303 100 <- Minus
3L 1834869..1835017 58..206 100 <- Minus
3L 1835106..1835161 1..57 98   Minus

RH05746.pep Sequence

Translation from 116 to 700

> RH05746.pep
MANFVCFVILSLALFASVAVARPGYALDYYDHPKYAFNYGVADHSTGDVK
SQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHA
QAVVASPIVAHKPVLTHYEPQVVKHVAPVAHAPLVVASPAPYVAKHYAPA
AAAPIHYDYDDGYYNQGQQYEYIPQYDQYSGHYGHYASPYAGHY*

RH05746.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24957-PA 189 GF24957-PA 1..189 1..194 829 91.3 Plus
Dana\GF24956-PA 188 GF24956-PA 6..119 3..97 288 53.5 Plus
Dana\GF10288-PA 157 GF10288-PA 76..145 27..96 282 80 Plus
Dana\GF10287-PA 375 GF10287-PA 45..109 33..97 259 75.4 Plus
Dana\GF23877-PA 204 GF23877-PA 57..181 14..128 255 46.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14556-PA 228 GG14556-PA 1..228 1..194 900 84.2 Plus
Dere\GG14555-PA 180 GG14555-PA 6..117 3..98 290 55.4 Plus
Dere\GG14302-PA 162 GG14302-PA 81..150 27..96 282 80 Plus
Dere\GG13610-PA 183 GG13610-PA 5..155 1..150 249 41.8 Plus
Dere\GG14209-PA 195 GG14209-PA 36..120 11..95 234 56.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15042-PA 191 GH15042-PA 1..191 1..194 744 84.3 Plus
Dgri\GH15041-PA 182 GH15041-PA 6..145 3..115 298 51.4 Plus
Dgri\GH15052-PA 136 GH15052-PA 50..136 33..118 284 65.5 Plus
Dgri\GH15054-PA 167 GH15054-PA 80..149 27..96 281 80 Plus
Dgri\GH15545-PA 117 GH15545-PA 7..106 8..115 247 51.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr62Bb-PC 194 CG13935-PC 1..194 1..194 1049 100 Plus
Cpr62Bb-PB 194 CG13935-PB 1..194 1..194 1049 100 Plus
Cpr62Bb-PA 194 CG13935-PA 1..194 1..194 1049 100 Plus
Cpr62Bc-PB 180 CG1919-PB 6..180 3..194 355 42.6 Plus
Cpr62Bc-PA 180 CG1919-PA 6..180 3..194 355 42.6 Plus
Ccp84Ab-PA 221 CG1252-PA 40..196 16..157 315 53.5 Plus
CG34461-PB 138 CG34461-PB 49..138 32..118 314 65.6 Plus
CG34461-PA 138 CG34461-PA 49..138 32..118 314 65.6 Plus
Ccp84Aa-PA 205 CG2360-PA 40..196 16..157 309 52.8 Plus
Cpr66Cb-PA 162 CG7076-PA 81..153 27..99 298 78.1 Plus
Ccp84Ad-PA 199 CG2341-PA 41..185 17..150 285 53.4 Plus
Cpr92A-PA 245 CG6240-PA 55..196 22..152 283 46.9 Plus
Cpr64Aa-PA 192 CG15006-PA 36..171 11..152 277 49.3 Plus
Edg84A-PA 188 CG2345-PA 11..167 9..157 270 41.4 Plus
Ccp84Ag-PA 191 CG2342-PA 12..173 6..153 258 39.6 Plus
Cpr64Ad-PB 247 CG1259-PB 143..245 32..155 254 52 Plus
Ccp84Ac-PA 217 CG1327-PA 62..201 32..189 248 42.6 Plus
Cpr64Ac-PA 188 CG15008-PA 71..164 14..110 241 53.6 Plus
Cpr76Bc-PD 424 CG9295-PD 50..120 29..99 239 64.8 Plus
Cpr76Bc-PC 424 CG9295-PC 50..120 29..99 239 64.8 Plus
Cpr64Ab-PA 120 CG15007-PA 39..119 32..115 235 59.5 Plus
Cpr76Bb-PA 198 CG9290-PA 63..152 15..101 233 55.6 Plus
Ccp84Ae-PA 208 CG1330-PA 48..160 32..155 233 47.6 Plus
Cpr31A-PA 340 CG33302-PA 133..293 33..179 230 40.5 Plus
Crys-PB 477 CG16963-PB 70..135 28..93 221 62.1 Plus
Crys-PA 477 CG16963-PA 70..135 28..93 221 62.1 Plus
Cpr23B-PA 302 CG2973-PA 141..241 19..119 216 44.6 Plus
Cpr76Ba-PA 204 CG9283-PA 97..166 32..101 213 58.6 Plus
Cpr76Bd-PD 1228 CG9299-PD 1140..1212 23..94 211 60.3 Plus
Cpr76Bd-PB 1228 CG9299-PB 1140..1212 23..94 211 60.3 Plus
Cpr76Bd-PC 1231 CG9299-PC 1143..1215 23..94 211 60.3 Plus
Cpr5C-PA 145 CG4052-PA 57..143 28..118 210 50.5 Plus
Ccp84Af-PA 151 CG1331-PA 38..148 16..146 207 44.1 Plus
CG13670-PA 266 CG13670-PA 92..243 24..181 199 31.4 Plus
Cpr30F-PA 146 CG31876-PA 45..138 35..150 194 44.8 Plus
Cpr35B-PA 218 CG3474-PA 64..139 28..102 179 51.3 Plus
CG42367-PC 103 CG42367-PC 8..97 8..93 176 46.2 Plus
Cpr30B-PA 153 CG3818-PA 7..131 4..123 149 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11676-PA 187 GI11676-PA 1..187 1..194 800 84 Plus
Dmoj\GI12933-PA 163 GI12933-PA 42..132 23..118 318 65.6 Plus
Dmoj\GI11675-PA 176 GI11675-PA 1..139 1..118 296 53.2 Plus
Dmoj\GI12820-PA 164 GI12820-PA 80..156 27..103 288 74 Plus
Dmoj\GI12819-PA 389 GI12819-PA 66..129 33..96 261 76.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24824-PA 195 GL24824-PA 1..195 1..194 827 86.8 Plus
Dper\GL24692-PA 133 GL24692-PA 47..133 33..118 300 69 Plus
Dper\GL24694-PA 159 GL24694-PA 78..147 27..96 282 80 Plus
Dper\GL24822-PA 183 GL24822-PA 6..147 3..118 281 44.4 Plus
Dper\GL21772-PA 223 GL21772-PA 34..143 28..132 233 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12639-PA 195 GA12639-PA 1..195 1..194 825 86.3 Plus
Dpse\GA23954-PA 133 GA23954-PA 47..133 33..118 300 69 Plus
Dpse\GA15131-PA 183 GA15131-PA 6..147 3..118 299 46.5 Plus
Dpse\GA20083-PA 159 GA20083-PA 78..147 27..96 282 80 Plus
Dpse\GA26397-PA 242 GA26397-PA 53..236 28..189 237 44.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14164-PA 225 GM14164-PA 1..225 1..194 867 82.5 Plus
Dsec\GM14163-PA 180 GM14163-PA 6..116 3..97 286 55 Plus
Dsec\GM25044-PA 162 GM25044-PA 81..150 27..96 282 80 Plus
Dsec\GM10909-PA 188 GM10909-PA 2..160 1..150 248 41.5 Plus
Dsec\GM13999-PA 195 GM13999-PA 36..120 11..95 234 56.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17606-PA 192 GD17606-PA 1..166 1..166 729 88 Plus
Dsim\GD14078-PA 177 GD14078-PA 89..177 33..118 295 66.3 Plus
Dsim\GD14081-PA 162 GD14081-PA 81..150 27..96 282 80 Plus
Dsim\GD13434-PA 180 GD13434-PA 6..116 3..97 282 54.1 Plus
Dsim\GD19888-PA 188 GD19888-PA 2..160 1..150 250 41.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12946-PA 185 GJ12946-PA 1..185 1..194 751 85.1 Plus
Dvir\GJ12961-PA 135 GJ12961-PA 49..135 33..118 299 69 Plus
Dvir\GJ12945-PA 178 GJ12945-PA 6..141 3..118 293 50.7 Plus
Dvir\GJ12963-PA 164 GJ12963-PA 80..149 27..96 280 80 Plus
Dvir\GJ23298-PA 181 GJ23298-PA 32..168 28..156 244 46.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20564-PA 195 GK20564-PA 1..195 1..194 836 86.3 Plus
Dwil\GK20563-PA 184 GK20563-PA 6..168 3..154 309 48.3 Plus
Dwil\GK11921-PA 158 GK11921-PA 77..146 27..96 281 80 Plus
Dwil\GK11910-PA 389 GK11910-PA 49..112 33..96 261 76.6 Plus
Dwil\GK10832-PA 179 GK10832-PA 52..165 32..151 253 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20910-PA 229 GE20910-PA 1..229 1..194 904 84.3 Plus
Dyak\GE20909-PA 180 GE20909-PA 6..116 3..97 286 55 Plus
Dyak\GE20730-PA 162 GE20730-PA 81..150 27..96 282 80 Plus
Dyak\GE18554-PA 476 GE18554-PA 64..134 23..93 244 59.2 Plus
Dyak\GE20635-PA 120 GE20635-PA 39..112 32..105 231 63.5 Plus

RH05746.hyp Sequence

Translation from 116 to 700

> RH05746.hyp
MANFVCFVILSLALFASVAVARPGYALDYYDHPKYAFNYGVADHSTGDVK
SQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHA
QAVVASPIVAHKPVLTHYEPQVVKHVAPVAHAPLVVASPAPYVAKHYAPA
AAAPIHYDYDDGYYNQGQQYEYIPQYDQYSGHYGHYASPYAGHY*

RH05746.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr62Bb-PC 194 CG13935-PC 1..194 1..194 1049 100 Plus
Cpr62Bb-PB 194 CG13935-PB 1..194 1..194 1049 100 Plus
Cpr62Bb-PA 194 CG13935-PA 1..194 1..194 1049 100 Plus
Cpr62Bc-PB 180 CG1919-PB 6..180 3..194 355 42.6 Plus
Cpr62Bc-PA 180 CG1919-PA 6..180 3..194 355 42.6 Plus