Clone RH06304 Report

Search the DGRC for RH06304

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:63
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG15201-RA
Protein status:RH06304.pep: gold
Sequenced Size:498

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15201 2001-12-17 Blastp of sequenced clone
CG15201 2002-01-01 Sim4 clustering to Release 2
CG15201 2003-01-01 Sim4 clustering to Release 3
CG15201 2008-04-29 Release 5.5 accounting
CG15201 2008-08-15 Release 5.9 accounting
CG15201 2008-12-18 5.12 accounting

Clone Sequence Records

RH06304.complete Sequence

498 bp (498 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071676

> RH06304.complete
GTCAGTCTCGTCACCGCGCTCCAAAGATGCACAACCGTTGCGGATCCATT
TGGCTGCTGGCGGCCGTCCTGCTGCTGCTGGCGCTCCTGCTTCCGCAGGC
ACTGCTGCCTACCGTCGATGCGGCCAGCGAACCCGTGTGCTCCTACCGCA
ACTCGGAGGATGAGACCATCTTTCTCAAGTATCTGCCGCTGCTGAGACGC
GGACAGGACTACGTGGACTTCGGCAAGGATGGCAAGTGCCTCAAGCGGGC
CATCTGCACGGACACCTTCAAGACCATCGTGGAGGACTGTGGACAGCAGA
AGGTCACCTGCGGCAACAAGGATCGCTTCACCGGAGTTTTCCCTGCCTGC
TGCCTCAAGTGTCCCTAAATCCGAGGAGTTTCATTAAGAACAGTGTATTC
AAATGTAGAAATGTAAACAGTAGACGATTAGCTAACGGAATATATGTGCT
ACCCATTCAATTACAGGGTATGCGATAACTATAAAAAAAAAAAAAAAA

RH06304.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15201-RA 617 CG15201-RA 95..577 2..484 2415 100 Plus
CG15201.a 794 CG15201.a 311..793 2..484 2415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11035843..11036038 287..482 980 100 Plus
chrX 22417052 chrX 11035548..11035711 123..286 820 100 Plus
chrX 22417052 chrX 11035357..11035478 2..123 595 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11144614..11144811 287..484 990 100 Plus
X 23542271 X 11144319..11144482 123..286 820 100 Plus
X 23542271 X 11144128..11144249 2..123 610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11152712..11152909 287..484 990 100 Plus
X 23527363 X 11152417..11152580 123..286 820 100 Plus
X 23527363 X 11152226..11152347 2..123 610 100 Plus
Blast to na_te.dros performed 2019-03-16 19:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1530..1602 107..38 114 65.8 Minus
blood 7410 blood BLOOD 7410bp 3120..3158 351..389 114 76.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2394 107..37 109 63.4 Minus
roo 9092 roo DM_ROO 9092bp 1064..1129 98..35 109 65.2 Minus
roo 9092 roo DM_ROO 9092bp 1057..1168 158..48 107 57.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6748..6823 108..35 105 61.8 Minus

RH06304.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:44:08 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11035355..11035478 1..123 98 -> Plus
chrX 11035549..11035711 124..286 100 -> Plus
chrX 11035843..11036038 287..482 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:41 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 1..342 27..368 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:46 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 1..342 27..368 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:34 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 1..342 27..368 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:28 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 1..342 27..368 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:41:03 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 1..342 27..368 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:28 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 7..489 1..482 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:46 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 7..489 1..482 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:34 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 7..489 1..482 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:28 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 7..489 1..482 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:41:03 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
CG15201-RA 7..489 1..482 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:08 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
X 11144614..11144809 287..482 100   Plus
X 11144126..11144249 1..123 99 -> Plus
X 11144320..11144482 124..286 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:08 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
X 11144614..11144809 287..482 100   Plus
X 11144126..11144249 1..123 99 -> Plus
X 11144320..11144482 124..286 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:08 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
X 11144614..11144809 287..482 100   Plus
X 11144126..11144249 1..123 99 -> Plus
X 11144320..11144482 124..286 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:34 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11038159..11038282 1..123 99 -> Plus
arm_X 11038353..11038515 124..286 100 -> Plus
arm_X 11038647..11038842 287..482 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:44 Download gff for RH06304.complete
Subject Subject Range Query Range Percent Splice Strand
X 11152224..11152347 1..123 99 -> Plus
X 11152418..11152580 124..286 100 -> Plus
X 11152712..11152907 287..482 100   Plus

RH06304.hyp Sequence

Translation from 0 to 367

> RH06304.hyp
VQSRHRAPKMHNRCGSIWLLAAVLLLLALLLPQALLPTVDAASEPVCSYR
NSEDETIFLKYLPLLRRGQDYVDFGKDGKCLKRAICTDTFKTIVEDCGQQ
KVTCGNKDRFTGVFPACCLKCP*

RH06304.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15201-PA 113 CG15201-PA 1..113 10..122 611 100 Plus

RH06304.pep Sequence

Translation from 26 to 367

> RH06304.pep
MHNRCGSIWLLAAVLLLLALLLPQALLPTVDAASEPVCSYRNSEDETIFL
KYLPLLRRGQDYVDFGKDGKCLKRAICTDTFKTIVEDCGQQKVTCGNKDR
FTGVFPACCLKCP*

RH06304.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20298-PA 108 GF20298-PA 10..108 11..113 423 75.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18395-PA 111 GG18395-PA 1..110 1..112 463 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24399-PA 108 GH24399-PA 2..108 4..112 416 69.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15201-PA 113 CG15201-PA 1..113 1..113 611 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15303-PA 103 GI15303-PA 24..103 34..113 376 81.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20279-PA 109 GL20279-PA 1..109 1..113 441 73.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13565-PA 109 GA13565-PA 1..109 1..113 436 73.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11461-PA 113 GM11461-PA 1..113 1..113 584 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16509-PA 112 GJ16509-PA 2..111 4..112 380 70.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15980-PA 94 GK15980-PA 13..93 32..112 398 88.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15913-PA 111 GE15913-PA 1..111 1..113 437 85.8 Plus