BDGP Sequence Production Resources |
Search the DGRC for RH06404
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 64 |
Well: | 4 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Gnmt-RA |
Protein status: | RH06404.pep: gold |
Preliminary Size: | 941 |
Sequenced Size: | 1005 |
Gene | Date | Evidence |
---|---|---|
CG6188 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6188 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6188 | 2003-01-22 | Blastp of sequenced clone |
CG6188 | 2008-04-29 | Release 5.5 accounting |
CG6188 | 2008-08-15 | Release 5.9 accounting |
CG6188 | 2008-12-18 | 5.12 accounting |
1005 bp (1005 high quality bases) assembled on 2003-01-22
GenBank Submission: BT003464
> RH06404.complete GATTCACTTGCAATCCGCCGACCAGTGCTGACCAACAGAGATGACAACCT CCGCTGACAGTGTGTTCGTTGCCCGATCCGATGGCATCTCCGCCGAAGGA GTCCGGGATCAGTACGCCGATGGCAAGGCCGCCAAGGTGTGGGAAATCTT CATCGGTGACAAAAACTCGCGTACGGACAACTACAAGAACTTCCTGATCG ATATGCTGCGCAATAAGGGATGCAAGCGTGTCCTAGACGTGGCCTGTGGA ACGGGTGTGGACTCCCTGATGCTTGTGGAGGAGGGCTTCGAAGTTGTGTC CGTAGATGCCTCTGATAAGATGTTGAAGTACGCCCTCAAGGAGCGCTGGG CCCGGCGAAATGAAGCTGCCTTCGATAAGTGGGTCATTGAGGAAGCCAAC TGGTTGACACTGTACGACGACATTCAGGAGCACATTCAGGATGGTTTCGA TGCCGTCATTTGCTTGGGCAACTCCTTTGCCCACTTGATGGACGGGTTCG GGGATCAGCGGGAGCACAAGCAGGCTATTGGCAACTTCGAAAAGTGCCTC AAGCCTGGAGGCGTCCTGCTTATCGATCATCGCAACTACGACAATATCCT GGAAACGGGAGCTACGCCTGCCAAGAGCATCTACTATAATACGAGTCACA CGGCGGACATCAAGACATCCGTGCTCTTCTACTGCGGTAAGCCCGCCCTG GTGTCGATGGACTACCTGATCGCTGGCAACAAGTTGACCAGTGAGTTCCG TCTGTCCTACTATCCCCACGGGCTGAAACGATTCCAGGAGATTCTAGCCG AGATCTTCTCCGCCAAAGCCAAGCACCAGTTGTATGGTGACTTCAAGGAG ATGAGCCAGGTGAAGAACCCCGCCTTCTACATTCACCTGATCGAAAAGCC ACAGGTTTAGATTTAAGTTTTTAGTTGTATTCACATAAGGCCACAAGACA CATCCATATAAATATACATAAAGTTCCTTCGATTCGCACAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 8500974..8501322 | 641..989 | 1685 | 98.9 | Plus |
chr3R | 27901430 | chr3R | 8500421..8500678 | 383..640 | 1290 | 100 | Plus |
chr3R | 27901430 | chr3R | 8499845..8500098 | 2..255 | 1255 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 8500233..8500361 | 255..383 | 615 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 12675736..12676085 | 641..990 | 1750 | 100 | Plus |
3R | 32079331 | 3R | 12675186..12675443 | 383..640 | 1290 | 100 | Plus |
3R | 32079331 | 3R | 12674610..12674863 | 2..255 | 1270 | 100 | Plus |
3R | 32079331 | 3R | 12674998..12675126 | 255..383 | 645 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 12416567..12416916 | 641..990 | 1750 | 100 | Plus |
3R | 31820162 | 3R | 12416017..12416274 | 383..640 | 1290 | 100 | Plus |
3R | 31820162 | 3R | 12415441..12415694 | 2..255 | 1270 | 100 | Plus |
3R | 31820162 | 3R | 12415829..12415957 | 255..383 | 645 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 8499844..8500098 | 1..255 | 99 | -> | Plus |
chr3R | 8500234..8500361 | 256..383 | 98 | -> | Plus |
chr3R | 8500422..8500678 | 384..640 | 100 | -> | Plus |
chr3R | 8500974..8501322 | 641..989 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 1..870 | 41..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 1..870 | 41..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 1..870 | 41..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 1..870 | 41..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gnmt-RA | 1..870 | 41..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 2..981 | 2..981 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 2..989 | 2..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 2..990 | 1..989 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6188-RA | 2..981 | 2..981 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Gnmt-RA | 2..990 | 1..989 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12674609..12674863 | 1..255 | 99 | -> | Plus |
3R | 12674999..12675126 | 256..383 | 100 | -> | Plus |
3R | 12675187..12675443 | 384..640 | 100 | -> | Plus |
3R | 12675736..12676084 | 641..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12674609..12674863 | 1..255 | 99 | -> | Plus |
3R | 12674999..12675126 | 256..383 | 100 | -> | Plus |
3R | 12675187..12675443 | 384..640 | 100 | -> | Plus |
3R | 12675736..12676084 | 641..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12674609..12674863 | 1..255 | 99 | -> | Plus |
3R | 12674999..12675126 | 256..383 | 100 | -> | Plus |
3R | 12675187..12675443 | 384..640 | 100 | -> | Plus |
3R | 12675736..12676084 | 641..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 8500331..8500585 | 1..255 | 99 | -> | Plus |
arm_3R | 8500721..8500848 | 256..383 | 100 | -> | Plus |
arm_3R | 8500909..8501165 | 384..640 | 100 | -> | Plus |
arm_3R | 8501458..8501806 | 641..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12415440..12415694 | 1..255 | 99 | -> | Plus |
3R | 12415830..12415957 | 256..383 | 100 | -> | Plus |
3R | 12416018..12416274 | 384..640 | 100 | -> | Plus |
3R | 12416567..12416915 | 641..989 | 100 | Plus |
Translation from 40 to 909
> RH06404.pep MTTSADSVFVARSDGISAEGVRDQYADGKAAKVWEIFIGDKNSRTDNYKN FLIDMLRNKGCKRVLDVACGTGVDSLMLVEEGFEVVSVDASDKMLKYALK ERWARRNEAAFDKWVIEEANWLTLYDDIQEHIQDGFDAVICLGNSFAHLM DGFGDQREHKQAIGNFEKCLKPGGVLLIDHRNYDNILETGATPAKSIYYN TSHTADIKTSVLFYCGKPALVSMDYLIAGNKLTSEFRLSYYPHGLKRFQE ILAEIFSAKAKHQLYGDFKEMSQVKNPAFYIHLIEKPQV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17115-PA | 289 | GF17115-PA | 1..289 | 1..289 | 1477 | 94.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19170-PA | 289 | GG19170-PA | 1..289 | 1..289 | 1534 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21361-PA | 290 | GH21361-PA | 1..287 | 1..287 | 1369 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gnmt-PA | 289 | CG6188-PA | 1..289 | 1..289 | 1520 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10501-PA | 289 | GI10501-PA | 1..289 | 1..289 | 1413 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27149-PA | 289 | GL27149-PA | 1..289 | 1..289 | 1496 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19423-PA | 289 | GA19423-PA | 1..289 | 1..289 | 1496 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24056-PA | 289 | GM24056-PA | 1..289 | 1..289 | 1535 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18854-PA | 289 | GD18854-PA | 1..289 | 1..289 | 1544 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23182-PA | 289 | GJ23182-PA | 1..289 | 1..289 | 1394 | 87.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13726-PA | 289 | GK13726-PA | 1..289 | 1..289 | 1419 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26214-PA | 289 | GE26214-PA | 1..288 | 1..288 | 1533 | 98.6 | Plus |
Translation from 40 to 909
> RH06404.hyp MTTSADSVFVARSDGISAEGVRDQYADGKAAKVWEIFIGDKNSRTDNYKN FLIDMLRNKGCKRVLDVACGTGVDSLMLVEEGFEVVSVDASDKMLKYALK ERWARRNEAAFDKWVIEEANWLTLYDDIQEHIQDGFDAVICLGNSFAHLM DGFGDQREHKQAIGNFEKCLKPGGVLLIDHRNYDNILETGATPAKSIYYN TSHTADIKTSVLFYCGKPALVSMDYLIAGNKLTSEFRLSYYPHGLKRFQE ILAEIFSAKAKHQLYGDFKEMSQVKNPAFYIHLIEKPQV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gnmt-PA | 289 | CG6188-PA | 1..289 | 1..289 | 1520 | 100 | Plus |