Clone RH06404 Report

Search the DGRC for RH06404

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:64
Well:4
Vector:pFlc-1
Associated Gene/TranscriptGnmt-RA
Protein status:RH06404.pep: gold
Preliminary Size:941
Sequenced Size:1005

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6188 2002-01-01 Sim4 clustering to Release 2
CG6188 2003-01-01 Sim4 clustering to Release 3
CG6188 2003-01-22 Blastp of sequenced clone
CG6188 2008-04-29 Release 5.5 accounting
CG6188 2008-08-15 Release 5.9 accounting
CG6188 2008-12-18 5.12 accounting

Clone Sequence Records

RH06404.complete Sequence

1005 bp (1005 high quality bases) assembled on 2003-01-22

GenBank Submission: BT003464

> RH06404.complete
GATTCACTTGCAATCCGCCGACCAGTGCTGACCAACAGAGATGACAACCT
CCGCTGACAGTGTGTTCGTTGCCCGATCCGATGGCATCTCCGCCGAAGGA
GTCCGGGATCAGTACGCCGATGGCAAGGCCGCCAAGGTGTGGGAAATCTT
CATCGGTGACAAAAACTCGCGTACGGACAACTACAAGAACTTCCTGATCG
ATATGCTGCGCAATAAGGGATGCAAGCGTGTCCTAGACGTGGCCTGTGGA
ACGGGTGTGGACTCCCTGATGCTTGTGGAGGAGGGCTTCGAAGTTGTGTC
CGTAGATGCCTCTGATAAGATGTTGAAGTACGCCCTCAAGGAGCGCTGGG
CCCGGCGAAATGAAGCTGCCTTCGATAAGTGGGTCATTGAGGAAGCCAAC
TGGTTGACACTGTACGACGACATTCAGGAGCACATTCAGGATGGTTTCGA
TGCCGTCATTTGCTTGGGCAACTCCTTTGCCCACTTGATGGACGGGTTCG
GGGATCAGCGGGAGCACAAGCAGGCTATTGGCAACTTCGAAAAGTGCCTC
AAGCCTGGAGGCGTCCTGCTTATCGATCATCGCAACTACGACAATATCCT
GGAAACGGGAGCTACGCCTGCCAAGAGCATCTACTATAATACGAGTCACA
CGGCGGACATCAAGACATCCGTGCTCTTCTACTGCGGTAAGCCCGCCCTG
GTGTCGATGGACTACCTGATCGCTGGCAACAAGTTGACCAGTGAGTTCCG
TCTGTCCTACTATCCCCACGGGCTGAAACGATTCCAGGAGATTCTAGCCG
AGATCTTCTCCGCCAAAGCCAAGCACCAGTTGTATGGTGACTTCAAGGAG
ATGAGCCAGGTGAAGAACCCCGCCTTCTACATTCACCTGATCGAAAAGCC
ACAGGTTTAGATTTAAGTTTTTAGTTGTATTCACATAAGGCCACAAGACA
CATCCATATAAATATACATAAAGTTCCTTCGATTCGCACAAAAAAAAAAA
AAAAA

RH06404.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6188-RA 1444 CG6188-RA 126..1114 2..990 4945 100 Plus
CG6188.a 1289 CG6188.a 34..1022 2..990 4945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8500974..8501322 641..989 1685 98.9 Plus
chr3R 27901430 chr3R 8500421..8500678 383..640 1290 100 Plus
chr3R 27901430 chr3R 8499845..8500098 2..255 1255 99.6 Plus
chr3R 27901430 chr3R 8500233..8500361 255..383 615 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:19:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12675736..12676085 641..990 1750 100 Plus
3R 32079331 3R 12675186..12675443 383..640 1290 100 Plus
3R 32079331 3R 12674610..12674863 2..255 1270 100 Plus
3R 32079331 3R 12674998..12675126 255..383 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12416567..12416916 641..990 1750 100 Plus
3R 31820162 3R 12416017..12416274 383..640 1290 100 Plus
3R 31820162 3R 12415441..12415694 2..255 1270 100 Plus
3R 31820162 3R 12415829..12415957 255..383 645 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:41:28 has no hits.

RH06404.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:42:33 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8499844..8500098 1..255 99 -> Plus
chr3R 8500234..8500361 256..383 98 -> Plus
chr3R 8500422..8500678 384..640 100 -> Plus
chr3R 8500974..8501322 641..989 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:45 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 1..870 41..910 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:21 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 1..870 41..910 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:07:51 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 1..870 41..910 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:24 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 1..870 41..910 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:14 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
Gnmt-RA 1..870 41..910 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:09:17 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 2..981 2..981 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:21 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 2..989 2..989 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:51 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 2..990 1..989 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:24 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
CG6188-RA 2..981 2..981 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:14 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
Gnmt-RA 2..990 1..989 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:33 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12674609..12674863 1..255 99 -> Plus
3R 12674999..12675126 256..383 100 -> Plus
3R 12675187..12675443 384..640 100 -> Plus
3R 12675736..12676084 641..989 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:33 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12674609..12674863 1..255 99 -> Plus
3R 12674999..12675126 256..383 100 -> Plus
3R 12675187..12675443 384..640 100 -> Plus
3R 12675736..12676084 641..989 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:33 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12674609..12674863 1..255 99 -> Plus
3R 12674999..12675126 256..383 100 -> Plus
3R 12675187..12675443 384..640 100 -> Plus
3R 12675736..12676084 641..989 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:51 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8500331..8500585 1..255 99 -> Plus
arm_3R 8500721..8500848 256..383 100 -> Plus
arm_3R 8500909..8501165 384..640 100 -> Plus
arm_3R 8501458..8501806 641..989 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:25 Download gff for RH06404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12415440..12415694 1..255 99 -> Plus
3R 12415830..12415957 256..383 100 -> Plus
3R 12416018..12416274 384..640 100 -> Plus
3R 12416567..12416915 641..989 100   Plus

RH06404.pep Sequence

Translation from 40 to 909

> RH06404.pep
MTTSADSVFVARSDGISAEGVRDQYADGKAAKVWEIFIGDKNSRTDNYKN
FLIDMLRNKGCKRVLDVACGTGVDSLMLVEEGFEVVSVDASDKMLKYALK
ERWARRNEAAFDKWVIEEANWLTLYDDIQEHIQDGFDAVICLGNSFAHLM
DGFGDQREHKQAIGNFEKCLKPGGVLLIDHRNYDNILETGATPAKSIYYN
TSHTADIKTSVLFYCGKPALVSMDYLIAGNKLTSEFRLSYYPHGLKRFQE
ILAEIFSAKAKHQLYGDFKEMSQVKNPAFYIHLIEKPQV*

RH06404.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17115-PA 289 GF17115-PA 1..289 1..289 1477 94.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19170-PA 289 GG19170-PA 1..289 1..289 1534 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21361-PA 290 GH21361-PA 1..287 1..287 1369 86.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Gnmt-PA 289 CG6188-PA 1..289 1..289 1520 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10501-PA 289 GI10501-PA 1..289 1..289 1413 88.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27149-PA 289 GL27149-PA 1..289 1..289 1496 95.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19423-PA 289 GA19423-PA 1..289 1..289 1496 95.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24056-PA 289 GM24056-PA 1..289 1..289 1535 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18854-PA 289 GD18854-PA 1..289 1..289 1544 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23182-PA 289 GJ23182-PA 1..289 1..289 1394 87.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13726-PA 289 GK13726-PA 1..289 1..289 1419 89.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26214-PA 289 GE26214-PA 1..288 1..288 1533 98.6 Plus

RH06404.hyp Sequence

Translation from 40 to 909

> RH06404.hyp
MTTSADSVFVARSDGISAEGVRDQYADGKAAKVWEIFIGDKNSRTDNYKN
FLIDMLRNKGCKRVLDVACGTGVDSLMLVEEGFEVVSVDASDKMLKYALK
ERWARRNEAAFDKWVIEEANWLTLYDDIQEHIQDGFDAVICLGNSFAHLM
DGFGDQREHKQAIGNFEKCLKPGGVLLIDHRNYDNILETGATPAKSIYYN
TSHTADIKTSVLFYCGKPALVSMDYLIAGNKLTSEFRLSYYPHGLKRFQE
ILAEIFSAKAKHQLYGDFKEMSQVKNPAFYIHLIEKPQV*

RH06404.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Gnmt-PA 289 CG6188-PA 1..289 1..289 1520 100 Plus