BDGP Sequence Production Resources |
Search the DGRC for RH06643
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 66 |
Well: | 43 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS29-RA |
Protein status: | RH06643.pep: gold |
Sequenced Size: | 516 |
Gene | Date | Evidence |
---|---|---|
CG8495 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8495 | 2003-01-01 | Sim4 clustering to Release 3 |
CG8495 | 2003-01-22 | Blastp of sequenced clone |
RpS29 | 2008-04-29 | Release 5.5 accounting |
RpS29 | 2008-08-15 | Release 5.9 accounting |
RpS29 | 2008-12-18 | 5.12 accounting |
516 bp (516 high quality bases) assembled on 2003-01-22
GenBank Submission: AY075533
> RH06643.complete GCCTTTTCTTTTCGAATTTCTCGTGGAAAACGCCAACATGGGTTTCGCTA CTCTCTGGTACTCGCATCCCCGCAAATATGGCCAAGGCTCCCGATGCTGC CGTGCCTGCTCTAACCGCCACGGTCTGATCCGCAAGTATGGCCTTAACAT CTGCCGCCAGTGCTTCAGGGAGTACGCCAACGACATTGGCTTCAAGAAGC TGGACTAAATGTGTCCTCTTCGCATTTTAACGCGGTAATCGCGTATATTA ATGCATATTAATGTATGGAGTCGTCGGATGTCGGGGACTCGGTAAATTAG TATGCCGGCAGCAACAGCAACAACAATAATCATTTGGGGATTTAAGCAAG GACAAAGCGCATCGAAGCATTGATTCAATATAGCCAGAATGGCCAACAGC AACACCACAAAATGCCAACAGTTACCACCTTCCGCGAAGGATCTTTGTTA AAGCACTAGTTTTGTTTAAATCTCCGCCTGATTAAACCCATAACAAGAAA CAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 5604609..5604912 | 198..501 | 1520 | 100 | Plus |
chr3R | 27901430 | chr3R | 5604452..5604552 | 99..199 | 505 | 100 | Plus |
chr3R | 27901430 | chr3R | 5603933..5604030 | 2..99 | 490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 5603932..5604030 | 1..99 | 98 | -> | Plus |
chr3R | 5604453..5604552 | 100..199 | 100 | -> | Plus |
chr3R | 5604611..5604912 | 200..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 1..171 | 38..208 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 1..171 | 38..208 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 1..171 | 38..208 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 1..171 | 38..208 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 1..171 | 38..208 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 3..503 | 1..501 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 54..554 | 1..501 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 2..502 | 1..501 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 3..503 | 1..501 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS29-RA | 2..502 | 1..501 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9778619..9778718 | 100..199 | 100 | -> | Plus |
3R | 9778777..9779078 | 200..501 | 100 | Plus | |
3R | 9778098..9778196 | 1..99 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9778619..9778718 | 100..199 | 100 | -> | Plus |
3R | 9778777..9779078 | 200..501 | 100 | Plus | |
3R | 9778098..9778196 | 1..99 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9778619..9778718 | 100..199 | 100 | -> | Plus |
3R | 9778777..9779078 | 200..501 | 100 | Plus | |
3R | 9778098..9778196 | 1..99 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 5603820..5603918 | 1..99 | 98 | -> | Plus |
arm_3R | 5604341..5604440 | 100..199 | 100 | -> | Plus |
arm_3R | 5604499..5604800 | 200..501 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9519608..9519909 | 200..501 | 100 | Plus | |
3R | 9518929..9519027 | 1..99 | 98 | -> | Plus |
3R | 9519450..9519549 | 100..199 | 100 | -> | Plus |
Translation from 0 to 207
> RH06643.hyp PFLFEFLVENANMGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNI CRQCFREYANDIGFKKLD*
Translation from 37 to 207
> RH06643.pep MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDI GFKKLD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17840-PA | 56 | GF17840-PA | 1..56 | 1..56 | 298 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17147-PA | 56 | GG17147-PA | 1..56 | 1..56 | 298 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17411-PA | 68 | GH17411-PA | 1..56 | 1..56 | 291 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS29-PB | 56 | CG8495-PB | 1..56 | 1..56 | 323 | 100 | Plus |
RpS29-PA | 56 | CG8495-PA | 1..56 | 1..56 | 323 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22741-PA | 56 | GI22741-PA | 1..56 | 1..56 | 290 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24306-PA | 56 | GL24306-PA | 1..56 | 1..56 | 298 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21118-PA | 56 | GA21118-PA | 1..56 | 1..56 | 298 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23839-PA | 56 | GM23839-PA | 1..56 | 1..56 | 291 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18649-PA | 56 | GD18649-PA | 1..56 | 1..56 | 298 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22743-PA | 501 | GJ22743-PA | 1..54 | 1..54 | 311 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11967-PA | 60 | GK11967-PA | 1..56 | 1..56 | 284 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25988-PA | 56 | GE25988-PA | 1..56 | 1..56 | 298 | 100 | Plus |