Clone RH06643 Report

Search the DGRC for RH06643

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:66
Well:43
Vector:pFlc-1
Associated Gene/TranscriptRpS29-RA
Protein status:RH06643.pep: gold
Sequenced Size:516

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8495 2002-01-01 Sim4 clustering to Release 2
CG8495 2003-01-01 Sim4 clustering to Release 3
CG8495 2003-01-22 Blastp of sequenced clone
RpS29 2008-04-29 Release 5.5 accounting
RpS29 2008-08-15 Release 5.9 accounting
RpS29 2008-12-18 5.12 accounting

Clone Sequence Records

RH06643.complete Sequence

516 bp (516 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075533

> RH06643.complete
GCCTTTTCTTTTCGAATTTCTCGTGGAAAACGCCAACATGGGTTTCGCTA
CTCTCTGGTACTCGCATCCCCGCAAATATGGCCAAGGCTCCCGATGCTGC
CGTGCCTGCTCTAACCGCCACGGTCTGATCCGCAAGTATGGCCTTAACAT
CTGCCGCCAGTGCTTCAGGGAGTACGCCAACGACATTGGCTTCAAGAAGC
TGGACTAAATGTGTCCTCTTCGCATTTTAACGCGGTAATCGCGTATATTA
ATGCATATTAATGTATGGAGTCGTCGGATGTCGGGGACTCGGTAAATTAG
TATGCCGGCAGCAACAGCAACAACAATAATCATTTGGGGATTTAAGCAAG
GACAAAGCGCATCGAAGCATTGATTCAATATAGCCAGAATGGCCAACAGC
AACACCACAAAATGCCAACAGTTACCACCTTCCGCGAAGGATCTTTGTTA
AAGCACTAGTTTTGTTTAAATCTCCGCCTGATTAAACCCATAACAAGAAA
CAAAAAAAAAAAAAAA

RH06643.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29.c 779 RpS29.c 86..585 2..501 2500 100 Plus
RpS29-RA 1085 RpS29-RA 86..585 2..501 2500 100 Plus
RpS29.a 1132 RpS29.a 86..585 2..501 2500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5604609..5604912 198..501 1520 100 Plus
chr3R 27901430 chr3R 5604452..5604552 99..199 505 100 Plus
chr3R 27901430 chr3R 5603933..5604030 2..99 490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9778775..9779078 198..501 1520 100 Plus
3R 32079331 3R 9778618..9778718 99..199 505 100 Plus
3R 32079331 3R 9778099..9778196 2..99 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9519606..9519909 198..501 1520 100 Plus
3R 31820162 3R 9519449..9519549 99..199 505 100 Plus
3R 31820162 3R 9518930..9519027 2..99 490 100 Plus
Blast to na_te.dros performed 2019-03-15 16:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
invader5 4038 invader5 INVADER5 4038bp 1108..1180 401..329 140 65.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2409..2503 309..407 106 63.4 Plus

RH06643.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:42:35 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5603932..5604030 1..99 98 -> Plus
chr3R 5604453..5604552 100..199 100 -> Plus
chr3R 5604611..5604912 200..501 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:39:51 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 1..171 38..208 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:27 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 1..171 38..208 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:07:55 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 1..171 38..208 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:16 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 1..171 38..208 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:46:17 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 1..171 38..208 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:37 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 3..503 1..501 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:27 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 54..554 1..501 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:55 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 2..502 1..501 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:17 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 3..503 1..501 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:46:17 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
RpS29-RA 2..502 1..501 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:35 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9778619..9778718 100..199 100 -> Plus
3R 9778777..9779078 200..501 100   Plus
3R 9778098..9778196 1..99 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:35 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9778619..9778718 100..199 100 -> Plus
3R 9778777..9779078 200..501 100   Plus
3R 9778098..9778196 1..99 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:42:35 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9778619..9778718 100..199 100 -> Plus
3R 9778777..9779078 200..501 100   Plus
3R 9778098..9778196 1..99 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:55 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5603820..5603918 1..99 98 -> Plus
arm_3R 5604341..5604440 100..199 100 -> Plus
arm_3R 5604499..5604800 200..501 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:07:28 Download gff for RH06643.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9519608..9519909 200..501 100   Plus
3R 9518929..9519027 1..99 98 -> Plus
3R 9519450..9519549 100..199 100 -> Plus

RH06643.hyp Sequence

Translation from 0 to 207

> RH06643.hyp
PFLFEFLVENANMGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNI
CRQCFREYANDIGFKKLD*

RH06643.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29-PB 56 CG8495-PB 1..56 13..68 323 100 Plus
RpS29-PA 56 CG8495-PA 1..56 13..68 323 100 Plus

RH06643.pep Sequence

Translation from 37 to 207

> RH06643.pep
MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDI
GFKKLD*

RH06643.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17840-PA 56 GF17840-PA 1..56 1..56 298 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17147-PA 56 GG17147-PA 1..56 1..56 298 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17411-PA 68 GH17411-PA 1..56 1..56 291 96.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
RpS29-PB 56 CG8495-PB 1..56 1..56 323 100 Plus
RpS29-PA 56 CG8495-PA 1..56 1..56 323 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22741-PA 56 GI22741-PA 1..56 1..56 290 96.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24306-PA 56 GL24306-PA 1..56 1..56 298 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21118-PA 56 GA21118-PA 1..56 1..56 298 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23839-PA 56 GM23839-PA 1..56 1..56 291 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18649-PA 56 GD18649-PA 1..56 1..56 298 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22743-PA 501 GJ22743-PA 1..54 1..54 311 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11967-PA 60 GK11967-PA 1..56 1..56 284 94.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25988-PA 56 GE25988-PA 1..56 1..56 298 100 Plus