BDGP Sequence Production Resources |
Search the DGRC for RH07321
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 73 |
Well: | 21 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG33470-RA |
Protein status: | RH07321.pep: gold |
Preliminary Size: | 1143 |
Sequenced Size: | 926 |
Gene | Date | Evidence |
---|---|---|
CG18279 | 2002-01-01 | Sim4 clustering to Release 2 |
CG18279 | 2003-01-01 | Sim4 clustering to Release 3 |
CG18279 | 2003-02-13 | Blastp of sequenced clone |
CG33470 | 2008-04-29 | Release 5.5 accounting |
IM10 | 2008-08-15 | Release 5.9 accounting |
IM10 | 2008-12-18 | 5.12 accounting |
926 bp (926 high quality bases) assembled on 2003-02-13
GenBank Submission: BT003754
> RH07321.complete ACCATTGAGTTGAAGCTGGGCTCTGGAACAGATCACAATGAAATCGTTTG GATTGATTGCACTGGCTATCTGTGGCGTTATCTGCGTCGCTGCGGAACCA CAACACACCTACGACGGTCGCAATGGGCCGCATGTCTTCGGTTCACCGGG CAATCAGGTCTATATAAGGGGCCAGAATGAAGGCACCTACAGCGTGCCGG GAGTGGGTGGCCAGTTCCAAAACGCTCCTCAACGGGGTGAGCATGTGTAC ACCGATGAGGCGGGCAACACGTTTGTTAACCGAAAGAACGCTGGTGGACC AGCTTCCCACACCATCAGTGGTCCCAATTTTTCCGCCAAAAATTTAGGGC CCAATGGAGCTAAGAGCGTGGGAATCCCACAACGTGCCCGGCGCAGTCCG CAGTTTCACGTAGAGCGTCCCGGTCGCACTGTTGACGTTGGAAACGGAGG ATTCTACATTCAGCGTGGCCGACGCAGTCCACAGCTTCATGTGGCACGCC CAGATCGCACCGTAACCATTGGTAATGGCGGCGTCTATATTCAACGCAGT CGACGCAGTCCACAGTTCCATGTGGAGCGACCAGATCGCACTGTTGATTT CGGTAACGGTGGCTTCTCCGCTCAACGTTTCCGCCGTGGGATCAACGATG CCCGCGTCCAGGGTGAGAACTTTGTGGCCCGCGACGATCAGGCAGGAATT TGGGACAATAATGTCTCCGTTTGGAAGCGTCCGGACGGACGCACTGTCAC AATCGATAGGAATGGTCATACCATCGTGTCCGGAAGGGGACGTCCCGCTC AGCACTACTGAAACGGTTTCAAATAAGTGTAACTTTAGACTGTAAAATAC GATTAATATGAGACTATGTATATAGCAACATAAATCACATGATATCTGAA TATGAAATCTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33470-RA | 910 | CG33470-RA | 8..910 | 8..910 | 4515 | 100 | Plus |
IM10-RA | 1060 | IM10-RA | 158..1060 | 8..910 | 4515 | 100 | Plus |
IM10-RB | 966 | IM10-RB | 8..805 | 8..805 | 3990 | 100 | Plus |
IM10-RB | 966 | IM10-RB | 862..966 | 806..910 | 525 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 9294784..9295289 | 300..805 | 2530 | 100 | Plus |
chr2R | 21145070 | chr2R | 9299511..9300016 | 300..805 | 2530 | 100 | Plus |
chr2R | 21145070 | chr2R | 9294514..9294727 | 89..302 | 1070 | 100 | Plus |
chr2R | 21145070 | chr2R | 9299241..9299454 | 89..302 | 1070 | 100 | Plus |
chr2R | 21145070 | chr2R | 9295346..9295450 | 806..910 | 525 | 100 | Plus |
chr2R | 21145070 | chr2R | 9300073..9300177 | 806..910 | 525 | 100 | Plus |
chr2R | 21145070 | chr2R | 9294360..9294441 | 8..89 | 410 | 100 | Plus |
chr2R | 21145070 | chr2R | 9299087..9299168 | 8..89 | 410 | 100 | Plus |
chr2R | 21145070 | chr2R | 4821693..4821800 | 641..748 | 300 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 13407437..13407942 | 300..805 | 2530 | 100 | Plus |
2R | 25286936 | 2R | 13412164..13412669 | 300..805 | 2530 | 100 | Plus |
2R | 25286936 | 2R | 13407167..13407380 | 89..302 | 1070 | 100 | Plus |
2R | 25286936 | 2R | 13411894..13412107 | 89..302 | 1070 | 100 | Plus |
2R | 25286936 | 2R | 13407999..13408104 | 806..911 | 530 | 100 | Plus |
2R | 25286936 | 2R | 13412726..13412831 | 806..911 | 530 | 100 | Plus |
2R | 25286936 | 2R | 13411740..13411821 | 8..89 | 410 | 100 | Plus |
2R | 25286936 | 2R | 13407013..13407094 | 8..89 | 410 | 100 | Plus |
2R | 25286936 | 2R | 8934132..8934239 | 641..748 | 300 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 13413363..13413868 | 300..805 | 2530 | 100 | Plus |
2R | 25260384 | 2R | 13408636..13409141 | 300..805 | 2530 | 100 | Plus |
2R | 25260384 | 2R | 13413093..13413306 | 89..302 | 1070 | 100 | Plus |
2R | 25260384 | 2R | 13408366..13408579 | 89..302 | 1070 | 100 | Plus |
2R | 25260384 | 2R | 13413925..13414030 | 806..911 | 530 | 100 | Plus |
2R | 25260384 | 2R | 13409198..13409303 | 806..911 | 530 | 100 | Plus |
2R | 25260384 | 2R | 13412939..13413020 | 8..89 | 410 | 100 | Plus |
2R | 25260384 | 2R | 13408212..13408293 | 8..89 | 410 | 100 | Plus |
2R | 25260384 | 2R | 8935331..8935438 | 641..748 | 300 | 85.1 | Plus |
2R | 25260384 | 2R | 8935171..8935217 | 552..598 | 145 | 87.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 9294353..9294441 | 1..89 | 95 | -> | Plus |
chr2R | 9294515..9294727 | 90..302 | 100 | -> | Plus |
chr2R | 9294787..9295289 | 303..805 | 100 | -> | Plus |
chr2R | 9295346..9295450 | 806..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RA | 1..774 | 38..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RC | 1..774 | 38..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RC | 1..774 | 38..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RA | 1..774 | 38..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM10-RC | 1..774 | 38..811 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RA | 3..910 | 3..910 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RA | 2..904 | 8..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RC | 2..904 | 8..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33470-RA | 3..910 | 3..910 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM10-RC | 1..905 | 6..910 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13407999..13408103 | 806..910 | 100 | Plus | |
2R | 13407440..13407942 | 303..805 | 100 | -> | Plus |
2R | 13407006..13407094 | 1..89 | 95 | -> | Plus |
2R | 13407168..13407380 | 90..302 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13407999..13408103 | 806..910 | 100 | Plus | |
2R | 13407440..13407942 | 303..805 | 100 | -> | Plus |
2R | 13407006..13407094 | 1..89 | 95 | -> | Plus |
2R | 13407168..13407380 | 90..302 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13407999..13408103 | 806..910 | 100 | Plus | |
2R | 13407440..13407942 | 303..805 | 100 | -> | Plus |
2R | 13407006..13407094 | 1..89 | 95 | -> | Plus |
2R | 13407168..13407380 | 90..302 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 9294511..9294599 | 1..89 | 95 | -> | Plus |
arm_2R | 9294673..9294885 | 90..302 | 100 | -> | Plus |
arm_2R | 9294945..9295447 | 303..805 | 100 | -> | Plus |
arm_2R | 9295504..9295608 | 806..910 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13408367..13408579 | 90..302 | 100 | -> | Plus |
2R | 13408639..13409141 | 303..805 | 100 | -> | Plus |
2R | 13409198..13409302 | 806..910 | 100 | Plus | |
2R | 13408205..13408293 | 1..89 | 95 | -> | Plus |
Translation from 37 to 810
> RH07321.pep MKSFGLIALAICGVICVAAEPQHTYDGRNGPHVFGSPGNQVYIRGQNEGT YSVPGVGGQFQNAPQRGEHVYTDEAGNTFVNRKNAGGPASHTISGPNFSA KNLGPNGAKSVGIPQRARRSPQFHVERPGRTVDVGNGGFYIQRGRRSPQL HVARPDRTVTIGNGGVYIQRSRRSPQFHVERPDRTVDFGNGGFSAQRFRR GINDARVQGENFVARDDQAGIWDNNVSVWKRPDGRTVTIDRNGHTIVSGR GRPAQHY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13690-PA | 259 | GF13690-PA | 1..257 | 1..257 | 969 | 73.8 | Plus |
Dana\GF12218-PA | 228 | GF12218-PA | 1..227 | 1..257 | 703 | 59.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20379-PA | 257 | GG20379-PA | 1..257 | 1..257 | 1241 | 92.6 | Plus |
Dere\GG20752-PA | 112 | GG20752-PA | 1..85 | 1..85 | 230 | 48.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23113-PA | 360 | GH23113-PA | 70..312 | 12..249 | 600 | 55.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IMPPP-PC | 257 | CG18279-PC | 1..257 | 1..257 | 1388 | 100 | Plus |
IMPPP-PA | 257 | CG18279-PA | 1..257 | 1..257 | 1388 | 100 | Plus |
CG33470-PC | 257 | CG33470-PC | 1..257 | 1..257 | 1388 | 100 | Plus |
CG33470-PA | 257 | CG33470-PA | 1..257 | 1..257 | 1388 | 100 | Plus |
CG13749-PB | 183 | CG13749-PB | 17..176 | 18..182 | 557 | 61.8 | Plus |
CG30285-PA | 112 | CG30285-PA | 1..85 | 1..85 | 254 | 51.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18936-PA | 241 | GI18936-PA | 9..239 | 22..257 | 523 | 53.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11683-PA | 305 | GL11683-PA | 1..261 | 1..255 | 905 | 71.6 | Plus |
Dper\GL11270-PA | 112 | GL11270-PA | 1..90 | 1..90 | 223 | 50.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24235-PA | 278 | GA24235-PA | 1..234 | 1..255 | 757 | 63.2 | Plus |
Dpse\GA15751-PA | 112 | GA15751-PA | 1..86 | 1..87 | 238 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21466-PA | 257 | GM21466-PA | 1..257 | 1..257 | 1264 | 94.6 | Plus |
Dsec\GM21080-PA | 272 | GM21080-PA | 1..272 | 1..256 | 770 | 56.8 | Plus |
Dsec\GM15695-PA | 112 | GM15695-PA | 1..84 | 1..84 | 265 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10965-PA | 268 | GD10965-PA | 1..255 | 1..255 | 1265 | 94.9 | Plus |
Dsim\GD10615-PA | 245 | GD10615-PA | 1..245 | 1..256 | 656 | 50.2 | Plus |
Dsim\GD25174-PA | 112 | GD25174-PA | 1..85 | 1..85 | 264 | 54.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21308-PA | 269 | GJ21308-PA | 5..267 | 18..257 | 637 | 57.9 | Plus |
Dvir\GJ21309-PA | 351 | GJ21309-PA | 1..253 | 18..249 | 598 | 55.9 | Plus |
Dvir\GJ21309-PA | 351 | GJ21309-PA | 269..335 | 18..84 | 208 | 59.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10648-PA | 346 | GK10648-PA | 19..344 | 20..257 | 634 | 48.6 | Plus |
Dwil\GK10645-PA | 175 | GK10645-PA | 1..156 | 1..154 | 327 | 50.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12540-PA | 259 | GE12540-PA | 1..259 | 1..257 | 1207 | 88.8 | Plus |
Dyak\GE19241-PA | 251 | GE19241-PA | 1..235 | 1..252 | 482 | 42.4 | Plus |
Dyak\GE13684-PA | 119 | GE13684-PA | 1..92 | 1..95 | 234 | 48.4 | Plus |
Translation from 37 to 810
> RH07321.hyp MKSFGLIALAICGVICVAAEPQHTYDGRNGPHVFGSPGNQVYIRGQNEGT YSVPGVGGQFQNAPQRGEHVYTDEAGNTFVNRKNAGGPASHTISGPNFSA KNLGPNGAKSVGIPQRARRSPQFHVERPGRTVDVGNGGFYIQRGRRSPQL HVARPDRTVTIGNGGVYIQRSRRSPQFHVERPDRTVDFGNGGFSAQRFRR GINDARVQGENFVARDDQAGIWDNNVSVWKRPDGRTVTIDRNGHTIVSGR GRPAQHY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33470-PC | 257 | CG33470-PC | 1..257 | 1..257 | 1388 | 100 | Plus |
CG33470-PA | 257 | CG33470-PA | 1..257 | 1..257 | 1388 | 100 | Plus |
IM10-PC | 257 | CG18279-PC | 1..257 | 1..257 | 1388 | 100 | Plus |
IM10-PA | 257 | CG18279-PA | 1..257 | 1..257 | 1388 | 100 | Plus |
CG13749-PB | 183 | CG13749-PB | 17..176 | 18..182 | 557 | 61.8 | Plus |