Clone RH07321 Report

Search the DGRC for RH07321

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:73
Well:21
Vector:pFlc-1
Associated Gene/TranscriptCG33470-RA
Protein status:RH07321.pep: gold
Preliminary Size:1143
Sequenced Size:926

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18279 2002-01-01 Sim4 clustering to Release 2
CG18279 2003-01-01 Sim4 clustering to Release 3
CG18279 2003-02-13 Blastp of sequenced clone
CG33470 2008-04-29 Release 5.5 accounting
IM10 2008-08-15 Release 5.9 accounting
IM10 2008-12-18 5.12 accounting

Clone Sequence Records

RH07321.complete Sequence

926 bp (926 high quality bases) assembled on 2003-02-13

GenBank Submission: BT003754

> RH07321.complete
ACCATTGAGTTGAAGCTGGGCTCTGGAACAGATCACAATGAAATCGTTTG
GATTGATTGCACTGGCTATCTGTGGCGTTATCTGCGTCGCTGCGGAACCA
CAACACACCTACGACGGTCGCAATGGGCCGCATGTCTTCGGTTCACCGGG
CAATCAGGTCTATATAAGGGGCCAGAATGAAGGCACCTACAGCGTGCCGG
GAGTGGGTGGCCAGTTCCAAAACGCTCCTCAACGGGGTGAGCATGTGTAC
ACCGATGAGGCGGGCAACACGTTTGTTAACCGAAAGAACGCTGGTGGACC
AGCTTCCCACACCATCAGTGGTCCCAATTTTTCCGCCAAAAATTTAGGGC
CCAATGGAGCTAAGAGCGTGGGAATCCCACAACGTGCCCGGCGCAGTCCG
CAGTTTCACGTAGAGCGTCCCGGTCGCACTGTTGACGTTGGAAACGGAGG
ATTCTACATTCAGCGTGGCCGACGCAGTCCACAGCTTCATGTGGCACGCC
CAGATCGCACCGTAACCATTGGTAATGGCGGCGTCTATATTCAACGCAGT
CGACGCAGTCCACAGTTCCATGTGGAGCGACCAGATCGCACTGTTGATTT
CGGTAACGGTGGCTTCTCCGCTCAACGTTTCCGCCGTGGGATCAACGATG
CCCGCGTCCAGGGTGAGAACTTTGTGGCCCGCGACGATCAGGCAGGAATT
TGGGACAATAATGTCTCCGTTTGGAAGCGTCCGGACGGACGCACTGTCAC
AATCGATAGGAATGGTCATACCATCGTGTCCGGAAGGGGACGTCCCGCTC
AGCACTACTGAAACGGTTTCAAATAAGTGTAACTTTAGACTGTAAAATAC
GATTAATATGAGACTATGTATATAGCAACATAAATCACATGATATCTGAA
TATGAAATCTAAAAAAAAAAAAAAAA

RH07321.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG33470-RA 910 CG33470-RA 8..910 8..910 4515 100 Plus
IM10-RA 1060 IM10-RA 158..1060 8..910 4515 100 Plus
IM10-RB 966 IM10-RB 8..805 8..805 3990 100 Plus
IM10-RB 966 IM10-RB 862..966 806..910 525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9294784..9295289 300..805 2530 100 Plus
chr2R 21145070 chr2R 9299511..9300016 300..805 2530 100 Plus
chr2R 21145070 chr2R 9294514..9294727 89..302 1070 100 Plus
chr2R 21145070 chr2R 9299241..9299454 89..302 1070 100 Plus
chr2R 21145070 chr2R 9295346..9295450 806..910 525 100 Plus
chr2R 21145070 chr2R 9300073..9300177 806..910 525 100 Plus
chr2R 21145070 chr2R 9294360..9294441 8..89 410 100 Plus
chr2R 21145070 chr2R 9299087..9299168 8..89 410 100 Plus
chr2R 21145070 chr2R 4821693..4821800 641..748 300 85.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13407437..13407942 300..805 2530 100 Plus
2R 25286936 2R 13412164..13412669 300..805 2530 100 Plus
2R 25286936 2R 13407167..13407380 89..302 1070 100 Plus
2R 25286936 2R 13411894..13412107 89..302 1070 100 Plus
2R 25286936 2R 13407999..13408104 806..911 530 100 Plus
2R 25286936 2R 13412726..13412831 806..911 530 100 Plus
2R 25286936 2R 13411740..13411821 8..89 410 100 Plus
2R 25286936 2R 13407013..13407094 8..89 410 100 Plus
2R 25286936 2R 8934132..8934239 641..748 300 85.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13413363..13413868 300..805 2530 100 Plus
2R 25260384 2R 13408636..13409141 300..805 2530 100 Plus
2R 25260384 2R 13413093..13413306 89..302 1070 100 Plus
2R 25260384 2R 13408366..13408579 89..302 1070 100 Plus
2R 25260384 2R 13413925..13414030 806..911 530 100 Plus
2R 25260384 2R 13409198..13409303 806..911 530 100 Plus
2R 25260384 2R 13412939..13413020 8..89 410 100 Plus
2R 25260384 2R 13408212..13408293 8..89 410 100 Plus
2R 25260384 2R 8935331..8935438 641..748 300 85.1 Plus
2R 25260384 2R 8935171..8935217 552..598 145 87.2 Plus
Blast to na_te.dros performed on 2019-03-16 00:07:42 has no hits.

RH07321.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:08:22 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9294353..9294441 1..89 95 -> Plus
chr2R 9294515..9294727 90..302 100 -> Plus
chr2R 9294787..9295289 303..805 100 -> Plus
chr2R 9295346..9295450 806..910 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:02 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RA 1..774 38..811 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:52:09 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RC 1..774 38..811 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:22 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RC 1..774 38..811 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:43:17 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RA 1..774 38..811 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:59:06 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
IM10-RC 1..774 38..811 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:06:03 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RA 3..910 3..910 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:52:09 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RA 2..904 8..910 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:22 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RC 2..904 8..910 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:43:17 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
CG33470-RA 3..910 3..910 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:59:06 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
IM10-RC 1..905 6..910 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:22 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13407999..13408103 806..910 100   Plus
2R 13407440..13407942 303..805 100 -> Plus
2R 13407006..13407094 1..89 95 -> Plus
2R 13407168..13407380 90..302 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:22 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13407999..13408103 806..910 100   Plus
2R 13407440..13407942 303..805 100 -> Plus
2R 13407006..13407094 1..89 95 -> Plus
2R 13407168..13407380 90..302 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:08:22 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13407999..13408103 806..910 100   Plus
2R 13407440..13407942 303..805 100 -> Plus
2R 13407006..13407094 1..89 95 -> Plus
2R 13407168..13407380 90..302 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:22 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9294511..9294599 1..89 95 -> Plus
arm_2R 9294673..9294885 90..302 100 -> Plus
arm_2R 9294945..9295447 303..805 100 -> Plus
arm_2R 9295504..9295608 806..910 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:14:04 Download gff for RH07321.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13408367..13408579 90..302 100 -> Plus
2R 13408639..13409141 303..805 100 -> Plus
2R 13409198..13409302 806..910 100   Plus
2R 13408205..13408293 1..89 95 -> Plus

RH07321.pep Sequence

Translation from 37 to 810

> RH07321.pep
MKSFGLIALAICGVICVAAEPQHTYDGRNGPHVFGSPGNQVYIRGQNEGT
YSVPGVGGQFQNAPQRGEHVYTDEAGNTFVNRKNAGGPASHTISGPNFSA
KNLGPNGAKSVGIPQRARRSPQFHVERPGRTVDVGNGGFYIQRGRRSPQL
HVARPDRTVTIGNGGVYIQRSRRSPQFHVERPDRTVDFGNGGFSAQRFRR
GINDARVQGENFVARDDQAGIWDNNVSVWKRPDGRTVTIDRNGHTIVSGR
GRPAQHY*

RH07321.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13690-PA 259 GF13690-PA 1..257 1..257 969 73.8 Plus
Dana\GF12218-PA 228 GF12218-PA 1..227 1..257 703 59.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20379-PA 257 GG20379-PA 1..257 1..257 1241 92.6 Plus
Dere\GG20752-PA 112 GG20752-PA 1..85 1..85 230 48.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23113-PA 360 GH23113-PA 70..312 12..249 600 55.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
IMPPP-PC 257 CG18279-PC 1..257 1..257 1388 100 Plus
IMPPP-PA 257 CG18279-PA 1..257 1..257 1388 100 Plus
CG33470-PC 257 CG33470-PC 1..257 1..257 1388 100 Plus
CG33470-PA 257 CG33470-PA 1..257 1..257 1388 100 Plus
CG13749-PB 183 CG13749-PB 17..176 18..182 557 61.8 Plus
CG30285-PA 112 CG30285-PA 1..85 1..85 254 51.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18936-PA 241 GI18936-PA 9..239 22..257 523 53.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11683-PA 305 GL11683-PA 1..261 1..255 905 71.6 Plus
Dper\GL11270-PA 112 GL11270-PA 1..90 1..90 223 50.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24235-PA 278 GA24235-PA 1..234 1..255 757 63.2 Plus
Dpse\GA15751-PA 112 GA15751-PA 1..86 1..87 238 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21466-PA 257 GM21466-PA 1..257 1..257 1264 94.6 Plus
Dsec\GM21080-PA 272 GM21080-PA 1..272 1..256 770 56.8 Plus
Dsec\GM15695-PA 112 GM15695-PA 1..84 1..84 265 54.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10965-PA 268 GD10965-PA 1..255 1..255 1265 94.9 Plus
Dsim\GD10615-PA 245 GD10615-PA 1..245 1..256 656 50.2 Plus
Dsim\GD25174-PA 112 GD25174-PA 1..85 1..85 264 54.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21308-PA 269 GJ21308-PA 5..267 18..257 637 57.9 Plus
Dvir\GJ21309-PA 351 GJ21309-PA 1..253 18..249 598 55.9 Plus
Dvir\GJ21309-PA 351 GJ21309-PA 269..335 18..84 208 59.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10648-PA 346 GK10648-PA 19..344 20..257 634 48.6 Plus
Dwil\GK10645-PA 175 GK10645-PA 1..156 1..154 327 50.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12540-PA 259 GE12540-PA 1..259 1..257 1207 88.8 Plus
Dyak\GE19241-PA 251 GE19241-PA 1..235 1..252 482 42.4 Plus
Dyak\GE13684-PA 119 GE13684-PA 1..92 1..95 234 48.4 Plus

RH07321.hyp Sequence

Translation from 37 to 810

> RH07321.hyp
MKSFGLIALAICGVICVAAEPQHTYDGRNGPHVFGSPGNQVYIRGQNEGT
YSVPGVGGQFQNAPQRGEHVYTDEAGNTFVNRKNAGGPASHTISGPNFSA
KNLGPNGAKSVGIPQRARRSPQFHVERPGRTVDVGNGGFYIQRGRRSPQL
HVARPDRTVTIGNGGVYIQRSRRSPQFHVERPDRTVDFGNGGFSAQRFRR
GINDARVQGENFVARDDQAGIWDNNVSVWKRPDGRTVTIDRNGHTIVSGR
GRPAQHY*

RH07321.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG33470-PC 257 CG33470-PC 1..257 1..257 1388 100 Plus
CG33470-PA 257 CG33470-PA 1..257 1..257 1388 100 Plus
IM10-PC 257 CG18279-PC 1..257 1..257 1388 100 Plus
IM10-PA 257 CG18279-PA 1..257 1..257 1388 100 Plus
CG13749-PB 183 CG13749-PB 17..176 18..182 557 61.8 Plus