BDGP Sequence Production Resources |
Search the DGRC for RH07540
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 75 |
Well: | 40 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS16-RA |
Protein status: | RH07540.pep: gold |
Preliminary Size: | 552 |
Sequenced Size: | 596 |
Gene | Date | Evidence |
---|---|---|
CG4046 | 2001-12-13 | Blastp of sequenced clone |
CG4046 | 2002-01-01 | Sim4 clustering to Release 2 |
RpS16 | 2008-04-29 | Release 5.5 accounting |
RpS16 | 2008-08-15 | Release 5.9 accounting |
RpS16 | 2008-12-18 | 5.12 accounting |
596 bp (596 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070671
> RH07540.complete GACTTCCGCTCTTTTCCTACCCAACTCGCGGAGCAAAATGCAGCAGAAGC GCAGAGAACCCGTGCAGGCTGTCCAGGTCTTCGGACGCAAGAAAACCGCC ACCGCCGTCGCTTACTGCAAGCGTGGCAACGGCCTCCTGAAGGTGAACGG TCGTCCTCTGGAGCAGATTGAACCCAAGGTCCTGCAATACAAACTGCAGG AGCCCCTTCTGTTGCTCGGCAAGGAGAAATTCGCCGGCGTCGACATCCGC GTGCGCGTTAGCGGTGGTGGTCATGTAGCCCAGATCTACGCCATCCGCCA GGCCATTTCCAAGGCTCTCGTTGCCTTCTACCAGAAATACGTCGATGAGG CCTCCAAGAAGGAGATCAAGGACATTCTGGTGCAGTACGACAGAACCCTG CTGGTCGGCGATCCGCGTCGCTGCGAGCCCAAGAAGTTCGGCGGTCCAGG TGCCCGTGCTCGCTACCAGAAGTCGTACCGTTAAACTACTCTGTCTGGTT TTCAATTTGGATTAGAGCTATTTTTTACAATTTGAAAATGGTTTGCACGC ACGTGCGAATAAAACGGAATAATTAACTGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS16-RA | 739 | RpS16-RA | 117..695 | 1..579 | 2895 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 18494248..18494488 | 339..579 | 1205 | 100 | Plus |
chr2R | 21145070 | chr2R | 18492998..18493132 | 90..224 | 675 | 100 | Plus |
chr2R | 21145070 | chr2R | 18493425..18493541 | 222..338 | 585 | 100 | Plus |
chr2R | 21145070 | chr2R | 18492611..18492659 | 1..49 | 245 | 100 | Plus |
chr2R | 21145070 | chr2R | 18492735..18492778 | 48..91 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 22607755..22607995 | 339..579 | 1205 | 100 | Plus |
2R | 25286936 | 2R | 22606507..22606641 | 90..224 | 675 | 100 | Plus |
2R | 25286936 | 2R | 22606932..22607048 | 222..338 | 585 | 100 | Plus |
2R | 25286936 | 2R | 22606121..22606169 | 1..49 | 245 | 100 | Plus |
2R | 25286936 | 2R | 22606245..22606288 | 48..91 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 22608954..22609194 | 339..579 | 1205 | 100 | Plus |
2R | 25260384 | 2R | 22607706..22607840 | 90..224 | 675 | 100 | Plus |
2R | 25260384 | 2R | 22608131..22608247 | 222..338 | 585 | 100 | Plus |
2R | 25260384 | 2R | 22607320..22607368 | 1..49 | 245 | 100 | Plus |
2R | 25260384 | 2R | 22607444..22607487 | 48..91 | 220 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 18494248..18494488 | 339..580 | 99 | Plus | |
chr2R | 18492611..18492659 | 1..49 | 100 | -> | Plus |
chr2R | 18492737..18492778 | 50..91 | 100 | -> | Plus |
chr2R | 18493000..18493131 | 92..223 | 100 | -> | Plus |
chr2R | 18493427..18493541 | 224..338 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..447 | 38..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..447 | 38..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..447 | 38..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..447 | 38..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..447 | 38..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..579 | 1..580 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..579 | 1..580 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RB | 176..754 | 1..579 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RA | 1..579 | 1..580 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS16-RB | 176..754 | 1..579 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22606121..22606169 | 1..49 | 100 | -> | Plus |
2R | 22606247..22606288 | 50..91 | 100 | -> | Plus |
2R | 22606509..22606640 | 92..223 | 100 | -> | Plus |
2R | 22606934..22607048 | 224..338 | 100 | -> | Plus |
2R | 22607755..22607995 | 339..580 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22606121..22606169 | 1..49 | 100 | -> | Plus |
2R | 22606247..22606288 | 50..91 | 100 | -> | Plus |
2R | 22606509..22606640 | 92..223 | 100 | -> | Plus |
2R | 22606934..22607048 | 224..338 | 100 | -> | Plus |
2R | 22607755..22607995 | 339..580 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22606121..22606169 | 1..49 | 100 | -> | Plus |
2R | 22606247..22606288 | 50..91 | 100 | -> | Plus |
2R | 22606509..22606640 | 92..223 | 100 | -> | Plus |
2R | 22606934..22607048 | 224..338 | 100 | -> | Plus |
2R | 22607755..22607995 | 339..580 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 18493626..18493674 | 1..49 | 100 | -> | Plus |
arm_2R | 18493752..18493793 | 50..91 | 100 | -> | Plus |
arm_2R | 18494014..18494145 | 92..223 | 100 | -> | Plus |
arm_2R | 18494439..18494553 | 224..338 | 100 | -> | Plus |
arm_2R | 18495260..18495500 | 339..580 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22608954..22609194 | 339..580 | 99 | Plus | |
2R | 22607320..22607368 | 1..49 | 100 | -> | Plus |
2R | 22607446..22607487 | 50..91 | 100 | -> | Plus |
2R | 22607708..22607839 | 92..223 | 100 | -> | Plus |
2R | 22608133..22608247 | 224..338 | 100 | -> | Plus |
Translation from 0 to 483
> RH07540.hyp TSALFLPNSRSKMQQKRREPVQAVQVFGRKKTATAVAYCKRGNGLLKVNG RPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRVRVSGGGHVAQIYAIRQ AISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPG ARARYQKSYR*
Translation from 37 to 483
> RH07540.pep MQQKRREPVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQ YKLQEPLLLLGKEKFAGVDIRVRVSGGGHVAQIYAIRQAISKALVAFYQK YVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPGARARYQKSYR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11903-PA | 148 | GF11903-PA | 1..148 | 1..148 | 750 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21057-PA | 148 | GG21057-PA | 1..148 | 1..148 | 757 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20474-PA | 148 | GH20474-PA | 1..148 | 1..148 | 749 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS16-PB | 148 | CG4046-PB | 1..148 | 1..148 | 754 | 100 | Plus |
RpS16-PA | 148 | CG4046-PA | 1..148 | 1..148 | 754 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21016-PA | 148 | GI21016-PA | 1..148 | 1..148 | 749 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11589-PA | 148 | GL11589-PA | 1..148 | 1..148 | 748 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17915-PA | 148 | GA17915-PA | 1..148 | 1..148 | 748 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15924-PA | 148 | GM15924-PA | 1..148 | 1..148 | 757 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11679-PA | 148 | GD11679-PA | 1..148 | 1..148 | 757 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21938-PA | 148 | GJ21938-PA | 1..148 | 1..148 | 749 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17896-PA | 148 | GK17896-PA | 1..148 | 1..148 | 748 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13998-PA | 148 | GE13998-PA | 1..148 | 1..148 | 757 | 100 | Plus |