Clone RH07540 Report

Search the DGRC for RH07540

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:75
Well:40
Vector:pFlc-1
Associated Gene/TranscriptRpS16-RA
Protein status:RH07540.pep: gold
Preliminary Size:552
Sequenced Size:596

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4046 2001-12-13 Blastp of sequenced clone
CG4046 2002-01-01 Sim4 clustering to Release 2
RpS16 2008-04-29 Release 5.5 accounting
RpS16 2008-08-15 Release 5.9 accounting
RpS16 2008-12-18 5.12 accounting

Clone Sequence Records

RH07540.complete Sequence

596 bp (596 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070671

> RH07540.complete
GACTTCCGCTCTTTTCCTACCCAACTCGCGGAGCAAAATGCAGCAGAAGC
GCAGAGAACCCGTGCAGGCTGTCCAGGTCTTCGGACGCAAGAAAACCGCC
ACCGCCGTCGCTTACTGCAAGCGTGGCAACGGCCTCCTGAAGGTGAACGG
TCGTCCTCTGGAGCAGATTGAACCCAAGGTCCTGCAATACAAACTGCAGG
AGCCCCTTCTGTTGCTCGGCAAGGAGAAATTCGCCGGCGTCGACATCCGC
GTGCGCGTTAGCGGTGGTGGTCATGTAGCCCAGATCTACGCCATCCGCCA
GGCCATTTCCAAGGCTCTCGTTGCCTTCTACCAGAAATACGTCGATGAGG
CCTCCAAGAAGGAGATCAAGGACATTCTGGTGCAGTACGACAGAACCCTG
CTGGTCGGCGATCCGCGTCGCTGCGAGCCCAAGAAGTTCGGCGGTCCAGG
TGCCCGTGCTCGCTACCAGAAGTCGTACCGTTAAACTACTCTGTCTGGTT
TTCAATTTGGATTAGAGCTATTTTTTACAATTTGAAAATGGTTTGCACGC
ACGTGCGAATAAAACGGAATAATTAACTGCAAAAAAAAAAAAAAAA

RH07540.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpS16-RA 739 RpS16-RA 117..695 1..579 2895 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18494248..18494488 339..579 1205 100 Plus
chr2R 21145070 chr2R 18492998..18493132 90..224 675 100 Plus
chr2R 21145070 chr2R 18493425..18493541 222..338 585 100 Plus
chr2R 21145070 chr2R 18492611..18492659 1..49 245 100 Plus
chr2R 21145070 chr2R 18492735..18492778 48..91 220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22607755..22607995 339..579 1205 100 Plus
2R 25286936 2R 22606507..22606641 90..224 675 100 Plus
2R 25286936 2R 22606932..22607048 222..338 585 100 Plus
2R 25286936 2R 22606121..22606169 1..49 245 100 Plus
2R 25286936 2R 22606245..22606288 48..91 220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22608954..22609194 339..579 1205 100 Plus
2R 25260384 2R 22607706..22607840 90..224 675 100 Plus
2R 25260384 2R 22608131..22608247 222..338 585 100 Plus
2R 25260384 2R 22607320..22607368 1..49 245 100 Plus
2R 25260384 2R 22607444..22607487 48..91 220 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:19:15 has no hits.

RH07540.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:20:03 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18494248..18494488 339..580 99   Plus
chr2R 18492611..18492659 1..49 100 -> Plus
chr2R 18492737..18492778 50..91 100 -> Plus
chr2R 18493000..18493131 92..223 100 -> Plus
chr2R 18493427..18493541 224..338 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:05 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..447 38..484 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:17:04 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..447 38..484 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:15 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..447 38..484 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:09 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..447 38..484 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:07 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..447 38..484 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:36 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..579 1..580 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:17:03 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..579 1..580 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:15 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RB 176..754 1..579 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:10 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RA 1..579 1..580 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:07 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
RpS16-RB 176..754 1..579 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:03 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22606121..22606169 1..49 100 -> Plus
2R 22606247..22606288 50..91 100 -> Plus
2R 22606509..22606640 92..223 100 -> Plus
2R 22606934..22607048 224..338 100 -> Plus
2R 22607755..22607995 339..580 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:03 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22606121..22606169 1..49 100 -> Plus
2R 22606247..22606288 50..91 100 -> Plus
2R 22606509..22606640 92..223 100 -> Plus
2R 22606934..22607048 224..338 100 -> Plus
2R 22607755..22607995 339..580 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:20:03 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22606121..22606169 1..49 100 -> Plus
2R 22606247..22606288 50..91 100 -> Plus
2R 22606509..22606640 92..223 100 -> Plus
2R 22606934..22607048 224..338 100 -> Plus
2R 22607755..22607995 339..580 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:15 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18493626..18493674 1..49 100 -> Plus
arm_2R 18493752..18493793 50..91 100 -> Plus
arm_2R 18494014..18494145 92..223 100 -> Plus
arm_2R 18494439..18494553 224..338 100 -> Plus
arm_2R 18495260..18495500 339..580 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:18 Download gff for RH07540.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22608954..22609194 339..580 99   Plus
2R 22607320..22607368 1..49 100 -> Plus
2R 22607446..22607487 50..91 100 -> Plus
2R 22607708..22607839 92..223 100 -> Plus
2R 22608133..22608247 224..338 100 -> Plus

RH07540.hyp Sequence

Translation from 0 to 483

> RH07540.hyp
TSALFLPNSRSKMQQKRREPVQAVQVFGRKKTATAVAYCKRGNGLLKVNG
RPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRVRVSGGGHVAQIYAIRQ
AISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPG
ARARYQKSYR*

RH07540.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
RpS16-PB 148 CG4046-PB 1..148 13..160 754 100 Plus
RpS16-PA 148 CG4046-PA 1..148 13..160 754 100 Plus

RH07540.pep Sequence

Translation from 37 to 483

> RH07540.pep
MQQKRREPVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQ
YKLQEPLLLLGKEKFAGVDIRVRVSGGGHVAQIYAIRQAISKALVAFYQK
YVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPGARARYQKSYR*

RH07540.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11903-PA 148 GF11903-PA 1..148 1..148 750 98.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21057-PA 148 GG21057-PA 1..148 1..148 757 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20474-PA 148 GH20474-PA 1..148 1..148 749 98.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
RpS16-PB 148 CG4046-PB 1..148 1..148 754 100 Plus
RpS16-PA 148 CG4046-PA 1..148 1..148 754 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21016-PA 148 GI21016-PA 1..148 1..148 749 98.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11589-PA 148 GL11589-PA 1..148 1..148 748 98.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17915-PA 148 GA17915-PA 1..148 1..148 748 98.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15924-PA 148 GM15924-PA 1..148 1..148 757 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11679-PA 148 GD11679-PA 1..148 1..148 757 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21938-PA 148 GJ21938-PA 1..148 1..148 749 98.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17896-PA 148 GK17896-PA 1..148 1..148 748 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13998-PA 148 GE13998-PA 1..148 1..148 757 100 Plus