Clone RH07711 Report

Search the DGRC for RH07711

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:77
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG3939-RA
Protein status:RH07711.pep: gold
Sequenced Size:748

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3939 2002-01-01 Sim4 clustering to Release 2
CG3939 2002-04-26 Blastp of sequenced clone
CG3939 2003-01-01 Sim4 clustering to Release 3
CG3939 2008-04-29 Release 5.5 accounting
CG3939 2008-08-15 Release 5.9 accounting
CG3939 2008-12-18 5.12 accounting

Clone Sequence Records

RH07711.complete Sequence

748 bp (748 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113558

> RH07711.complete
GACTAGTTGCTGGAGCTTGCCGCAAAAAAAAAAAAAAAGAAAACAAAACA
GATCGAAAAACACAGCAAACAACAAAATTATACGCCATTAATTACCCGAT
AAACTTACCGATGGCCGATAAGCAACGGCTAAGTGATCCGTAACACCCAG
CGATAAGATCCAGATAAGATTGGAATTAAATTTTGGGTTTGCCATCCGCA
TCGAAATCGCCGCAATCGGAATTTACTTGTACACCAGCCAACTCGCCGTT
CAAGACGTCCAAGTTTTTTTTAATCCAGAAATCCCATACACTGCCAAAAT
GCCCGAATATGTGCCGGCACGGGGCTTCAAGGAGATGGAAAATCTGATCA
AGCTGTACGAGAACCAGCGCAGCCCCATCTACATCTACTTCTACGGCGAG
AAAGACAAGGACGGACGCAGCTGGTGTCCGGACTGCGTGGCGGCCGAGGA
AACTATCATGAGTGCCTTTCGCAACCACGCGCCGGCGGATTGCATGATCC
TGGTGGTGGACGTGGGTAGCCGGGAATCCTGGATAGGCAAGGACAACATG
TTCCGAAAGCCGCCATACTCGGTGGAAGGCATACCGACCCTTATACGCTG
GAAGGGCGTGGAGCGCCTGGATGGGGATCAGCTGCTCAAGTCGAGTCTTC
TGGAGCTCTTTTTCGAGGAGACCGATCCGAAGAAGTCCAATTTTGTCGCC
CAATAAAACGCGATTTGGCTTTGGCTTAAACTCAAAAAAAAAAAAAAA

RH07711.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG3939-RA 980 CG3939-RA 99..831 2..734 3665 100 Plus
Fcp3C-RA 2062 Fcp3C-RA 1..299 407..109 1495 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3068893..3069334 2..443 2165 99.3 Plus
chrX 22417052 chrX 3069609..3069899 443..733 1455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3175217..3175658 2..443 2210 100 Plus
X 23542271 X 3175933..3176224 443..734 1460 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3183315..3183756 2..443 2210 100 Plus
X 23527363 X 3184031..3184322 443..734 1460 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:48:14 has no hits.

RH07711.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:49:18 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3068892..3069334 1..443 99 -> Plus
chrX 3069610..3069899 444..733 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:08 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 1..408 299..706 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:09:35 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 1..408 299..706 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:39 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 1..408 299..706 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:00:29 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 1..408 299..706 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:54:44 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 1..408 299..706 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:30:30 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 98..830 1..733 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:09:34 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 98..830 1..733 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:39 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 199..931 1..733 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:00:29 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 98..830 1..733 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:54:44 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
CG3939-RA 199..931 1..733 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:18 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
X 3175216..3175658 1..443 99 -> Plus
X 3175934..3176223 444..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:18 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
X 3175216..3175658 1..443 99 -> Plus
X 3175934..3176223 444..733 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:49:18 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
X 3175216..3175658 1..443 99 -> Plus
X 3175934..3176223 444..733 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:39 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3069249..3069691 1..443 99 -> Plus
arm_X 3069967..3070256 444..733 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:32:00 Download gff for RH07711.complete
Subject Subject Range Query Range Percent Splice Strand
X 3183314..3183756 1..443 99 -> Plus
X 3184032..3184321 444..733 100   Plus

RH07711.hyp Sequence

Translation from 298 to 705

> RH07711.hyp
MPEYVPARGFKEMENLIKLYENQRSPIYIYFYGEKDKDGRSWCPDCVAAE
ETIMSAFRNHAPADCMILVVDVGSRESWIGKDNMFRKPPYSVEGIPTLIR
WKGVERLDGDQLLKSSLLELFFEETDPKKSNFVAQ*

RH07711.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG3939-PB 135 CG3939-PB 1..135 1..135 725 100 Plus
CG3939-PA 135 CG3939-PA 1..135 1..135 725 100 Plus
cl-PC 126 CG11024-PC 8..126 8..126 224 39.2 Plus
cl-PB 126 CG11024-PB 8..126 8..126 224 39.2 Plus
cl-PA 126 CG11024-PA 8..126 8..126 224 39.2 Plus

RH07711.pep Sequence

Translation from 298 to 705

> RH07711.pep
MPEYVPARGFKEMENLIKLYENQRSPIYIYFYGEKDKDGRSWCPDCVAAE
ETIMSAFRNHAPADCMILVVDVGSRESWIGKDNMFRKPPYSVEGIPTLIR
WKGVERLDGDQLLKSSLLELFFEETDPKKSNFVAQ*

RH07711.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19600-PA 132 GF19600-PA 1..132 1..131 521 72 Plus
Dana\GF15144-PA 126 GF15144-PA 7..126 7..126 212 37.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18647-PA 135 GG18647-PA 1..135 1..135 673 91.9 Plus
Dere\GG25076-PA 176 GG25076-PA 57..176 7..126 223 38 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24687-PA 139 GH24687-PA 1..132 1..131 385 51.5 Plus
Dgri\GH10293-PA 128 GH10293-PA 7..128 7..126 199 35.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3939-PB 135 CG3939-PB 1..135 1..135 725 100 Plus
CG3939-PA 135 CG3939-PA 1..135 1..135 725 100 Plus
cl-PC 126 CG11024-PC 8..126 8..126 224 39.2 Plus
cl-PB 126 CG11024-PB 8..126 8..126 224 39.2 Plus
cl-PA 126 CG11024-PA 8..126 8..126 224 39.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11174-PA 140 GI11174-PA 1..126 1..124 367 51.6 Plus
Dmoj\GI17989-PA 122 GI17989-PA 7..120 7..124 161 30.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19952-PA 141 GL19952-PA 1..129 1..128 417 65.4 Plus
Dper\GL25848-PA 102 GL25848-PA 9..102 33..126 182 42.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17789-PA 141 GA17789-PA 1..129 1..128 421 65.4 Plus
Dpse\GA10712-PA 126 GA10712-PA 7..126 7..126 219 38 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19265-PA 82 GM19265-PA 1..82 54..135 402 93.9 Plus
Dsec\GM18551-PA 176 GM18551-PA 57..176 7..126 227 38.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16632-PA 135 GD16632-PA 1..135 1..135 708 97.8 Plus
Dsim\GD23345-PA 176 GD23345-PA 57..176 7..126 228 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15300-PA 140 GJ15300-PA 1..127 1..125 391 54.3 Plus
Dvir\GJ19575-PA 128 GJ19575-PA 7..126 7..124 200 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10352-PA 135 GK10352-PA 1..131 1..131 379 57.3 Plus
Dwil\GK15089-PA 127 GK15089-PA 7..127 7..126 207 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16296-PA 135 GE16296-PA 1..135 1..135 670 91.9 Plus
Dyak\cl-PA 176 GE25439-PA 57..176 7..126 231 38.8 Plus