Clone RH08259 Report

Search the DGRC for RH08259

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:82
Well:59
Vector:pFlc-1
Associated Gene/TranscriptCG8736-RB
Protein status:RH08259.pep: gold
Preliminary Size:645
Sequenced Size:782

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8736 2002-01-01 Sim4 clustering to Release 2
CG8736 2002-04-21 Blastp of sequenced clone
CG8736 2008-04-29 Release 5.5 accounting
CG8736 2008-08-15 Release 5.9 accounting
CG8736 2008-12-18 5.12 accounting

Clone Sequence Records

RH08259.complete Sequence

782 bp (782 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113559

> RH08259.complete
ACCAGAGCAGTGCAGCGCCGACCAGGAACCCAATTGGAAGTTTGAGCTAC
GACTCCATAGTCCAATTCGGCAAGGATTACCATAAGCCCCACACCAGAAC
CAACTCCACAACTACCAACCACCCACTCACCTCAGCCAACATGTTCTGCA
AGCTGCTTTTCGCTACCTTCGTGGCCCTGGCGGTGGCCAAGCCACAACAC
CAACCTGCTGCCCAGTATCCGGCTGGCGTGAATCCGCAGGACTGCCCCAA
CTTCCCCATCTGTGATAATGCGCGCCTGCACAATCCGCAGCCGCAGTGGG
GTGCCCCGCAGCCACAGTGGAACCCCCAGCCGCAGCCACAGTGGAACCCG
CAGCCACAGTGGCAGCAACCTCAACCCCAGTGGAACCCCCAGCCGCAGCC
ACAGTGGCAGGCACAGCCCTCGTGGAACGCAGCCCCTGCTGCCGCACCCG
GTGGCGATAAGTATCCAGCTGGCGTCAATCCGCAGACCTGCCCCAACTAT
CCCTACTGCGACGTGAACGCCGGACACGCTGGTGCTCCCGTGGCAGCTCC
TCCTCTACCTGGCTGGACGGAGCGTCTGTATCCCGCCGGAGTTTCGCCGC
ACCAGTGCCCCAACTTCCCGTACTGCAACTAGGGCGGCCTAGGGCTCACT
TGCGGCCAGCCGCAGCTTCCTTTAACGCTTCGCCTTTCCCCAGTTCTCAA
TTAGTGGACATTAATCTGAAATTCTTTGTTGTTGGCGCCGAAATAAATGC
AAAATGTTGGTCAAAGAAAAAAAAAAAAAAAA

RH08259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8736-RB 938 CG8736-RB 124..887 6..769 3820 100 Plus
CG8736.b 1240 CG8736.b 426..1189 6..769 3820 100 Plus
CG8736.a 2060 CG8736.a 1246..2009 6..769 3820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4481617..4482228 766..155 3030 99.7 Minus
chr2R 21145070 chr2R 4482442..4482591 155..6 750 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8594028..8594642 769..155 3075 100 Minus
2R 25286936 2R 8594849..8594998 155..6 750 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8595227..8595841 769..155 3075 100 Minus
2R 25260384 2R 8596048..8596197 155..6 750 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:01:44 has no hits.

RH08259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:02:25 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4481617..4481963 420..766 99 == Minus
chr2R 4482060..4482227 156..323 100 <- Minus
chr2R 4482442..4482594 1..155 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:18 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..492 141..632 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:40 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..492 141..632 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:43:03 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..492 141..632 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:59 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..492 141..632 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:25:17 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..492 141..632 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:28 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..764 4..766 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:39 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..764 4..766 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:03 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..764 4..766 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:59 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..764 4..766 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:25:17 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
CG8736-RB 1..764 4..766 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:25 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8594031..8594641 156..766 100 <- Minus
2R 8594849..8595001 1..155 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:25 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8594031..8594641 156..766 100 <- Minus
2R 8594849..8595001 1..155 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:25 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8594031..8594641 156..766 100 <- Minus
2R 8594849..8595001 1..155 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:03 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4481536..4482146 156..766 100 <- Minus
arm_2R 4482354..4482506 1..155 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:06 Download gff for RH08259.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8595230..8595840 156..766 100 <- Minus
2R 8596048..8596200 1..155 98   Minus

RH08259.hyp Sequence

Translation from 0 to 631

> RH08259.hyp
SSSAAPTRNPIGSLSYDSIVQFGKDYHKPHTRTNSTTTNHPLTSANMFCK
LLFATFVALAVAKPQHQPAAQYPAGVNPQDCPNFPICDNARLHNPQPQWG
APQPQWNPQPQPQWNPQPQWQQPQPQWNPQPQPQWQAQPSWNAAPAAAPG
GDKYPAGVNPQTCPNYPYCDVNAGHAGAPVAAPPLPGWTERLYPAGVSPH
QCPNFPYCN*

RH08259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8736-PB 163 CG8736-PB 1..163 47..209 978 100 Plus

RH08259.pep Sequence

Translation from 2 to 631

> RH08259.pep
QSSAAPTRNPIGSLSYDSIVQFGKDYHKPHTRTNSTTTNHPLTSANMFCK
LLFATFVALAVAKPQHQPAAQYPAGVNPQDCPNFPICDNARLHNPQPQWG
APQPQWNPQPQPQWNPQPQWQQPQPQWNPQPQPQWQAQPSWNAAPAAAPG
GDKYPAGVNPQTCPNYPYCDVNAGHAGAPVAAPPLPGWTERLYPAGVSPH
QCPNFPYCN*

RH08259.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12575-PA 162 GF12575-PA 1..162 47..209 527 77.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10631-PA 165 GG10631-PA 1..165 47..209 789 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22145-PA 163 GH22145-PA 1..163 47..209 452 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG8736-PB 163 CG8736-PB 1..163 47..209 978 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19375-PA 162 GI19375-PA 1..48 47..94 203 81.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11020-PA 168 GL11020-PA 1..168 47..209 506 74.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24576-PA 168 GA24576-PA 1..168 47..209 506 74.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20677-PA 214 GM20677-PA 7..214 2..209 1044 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10155-PA 214 GD10155-PA 7..214 2..209 1050 99.5 Plus
Dsim\GD15271-PA 163 GD15271-PA 1..163 47..209 807 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19933-PA 163 GJ19933-PA 1..163 47..209 321 76.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23212-PA 163 GK23212-PA 1..162 47..208 486 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:38:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22901-PA 163 GE22901-PA 1..163 47..209 807 99.4 Plus