Clone RH08291 Report

Search the DGRC for RH08291

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:82
Well:91
Vector:pFlc-1
Associated Gene/TranscriptIM2-RA
Protein status:RH08291.pep: gold
Sequenced Size:383

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18106 2001-12-17 Blastp of sequenced clone
CG18106 2002-01-01 Sim4 clustering to Release 2
IM2 2008-04-29 Release 5.5 accounting
IM2 2008-08-15 Release 5.9 accounting
IM2 2008-12-18 5.12 accounting

Clone Sequence Records

RH08291.complete Sequence

383 bp (383 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071680

> RH08291.complete
GATCAGTTGAATTCAATCGATTGCTTGTGCATTTAGCAAATCAAAGCCAC
AACAACCAAACCAGAATCAATATGAAGTTCTTCTCAGTCGTCACCGTCTT
TGTGTTCGGTCTGCTGGCTCTGGCCAACGCTGTTCCCCTGTCGCCCGATC
CAGGAAATGTGGTAATCAACGGGGACTGCAAATACTGCAATGTGCACGGT
GGAAAGTAGGAAAGTAGGAAAGTAGGAAAGTACTCGCCTTAATTTCGAAG
ATGGGCCAAAACTTACCTCAAATCCAAAGCACCATATTTATACTCTCACT
CTTGTACTAAAATGAAAACTAGTAGTAAAAAATACATCGCCAATTACAAA
TAAAATGGTGAAAAAACAAAAAAAAAAAAAAAA

RH08291.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-RA 472 IM2-RA 103..472 2..371 1850 100 Plus
IM1-RA 524 IM1-RA 181..332 61..212 490 88.1 Plus
CG18107-RA 283 CG18107-RA 66..179 65..178 255 81.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14273836..14274058 129..367 875 92.1 Plus
chr2R 21145070 chr2R 14273645..14273774 2..129 570 97.7 Plus
chr2R 21145070 chr2R 14271060..14271133 54..127 295 93.2 Plus
chr2R 21145070 chr2R 14271201..14271284 129..212 240 85.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:20:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18386792..18387034 129..371 1215 100 Plus
2R 25286936 2R 18386603..18386730 2..129 640 100 Plus
2R 25286936 2R 18384012..18384078 61..127 275 94 Plus
2R 25286936 2R 18384149..18384232 129..212 225 84.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18387991..18388233 129..371 1215 100 Plus
2R 25260384 2R 18387802..18387929 2..129 640 100 Plus
2R 25260384 2R 18385211..18385277 61..127 275 94 Plus
2R 25260384 2R 18385348..18385431 129..212 225 84.5 Plus
Blast to na_te.dros performed on 2019-03-15 14:33:18 has no hits.

RH08291.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:34:22 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14273643..14273774 1..129 96 -> Plus
chr2R 14273837..14273907 130..200 98 == Plus
chr2R 14273924..14274058 233..367 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:40:19 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:29 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:34:15 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:06:51 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:02:26 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 1..138 72..209 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:15 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 5..372 1..367 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:29 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 5..372 1..367 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:34:15 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 2..367 2..367 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:06:52 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 5..372 1..367 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:02:26 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
IM2-RA 2..367 2..367 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:22 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18386601..18386730 1..129 99 -> Plus
2R 18386793..18387030 130..367 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:22 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18386601..18386730 1..129 99 -> Plus
2R 18386793..18387030 130..367 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:22 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18386601..18386730 1..129 99 -> Plus
2R 18386793..18387030 130..367 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:34:15 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14274298..14274535 130..367 100   Plus
arm_2R 14274106..14274235 1..129 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:28 Download gff for RH08291.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18387800..18387929 1..129 99 -> Plus
2R 18387992..18388229 130..367 100   Plus

RH08291.hyp Sequence

Translation from 0 to 208

> RH08291.hyp
ASVEFNRLLVHLANQSHNNQTRINMKFFSVVTVFVFGLLALANAVPLSPD
PGNVVINGDCKYCNVHGGK*

RH08291.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-PA 45 CG18106-PA 1..45 25..69 241 100 Plus
IM1-PA 45 CG18108-PA 1..45 25..69 220 88.9 Plus
CG18107-PA 45 CG18107-PA 1..45 25..69 202 80 Plus
CG15068-PA 40 CG15068-PA 1..39 25..67 132 65.1 Plus
IM3-PB 39 CG16844-PB 1..37 25..65 130 68.3 Plus

RH08291.pep Sequence

Translation from 71 to 208

> RH08291.pep
MKFFSVVTVFVFGLLALANAVPLSPDPGNVVINGDCKYCNVHGGK*

RH08291.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12155-PA 45 GF12155-PA 1..45 1..45 222 95.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21876-PA 45 GG21876-PA 1..45 1..45 213 91.1 Plus
Dere\GG21874-PA 45 GG21874-PA 1..45 1..45 210 91.1 Plus
Dere\GG21875-PA 45 GG21875-PA 1..45 1..45 183 77.8 Plus
Dere\GG21877-PA 39 GG21877-PA 1..39 1..43 130 67.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
IM2-PA 45 CG18106-PA 1..45 1..45 241 100 Plus
IM1-PA 45 CG18108-PA 1..45 1..45 220 88.9 Plus
CG18107-PA 45 CG18107-PA 1..45 1..45 202 80 Plus
CG15068-PA 40 CG15068-PA 1..39 1..43 132 65.1 Plus
IM3-PB 39 CG16844-PB 1..37 1..41 130 68.3 Plus
IM3-PA 39 CG16844-PA 1..37 1..41 130 68.3 Plus
CG15065-PA 40 CG15065-PA 1..40 1..44 126 61.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20115-PA 45 GI20115-PA 1..45 1..45 222 97.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17764-PA 45 GL17764-PA 1..45 1..45 222 97.8 Plus
Dper\GL16705-PA 40 GL16705-PA 1..39 1..43 125 62.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14796-PA 45 GA14796-PA 1..45 1..45 222 97.8 Plus
Dpse\GA30478-PA 40 GA30478-PA 1..39 1..43 127 65.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21868-PA 45 GM21868-PA 1..45 1..45 227 100 Plus
Dsec\GM21866-PA 45 GM21866-PA 1..45 1..45 209 88.9 Plus
Dsec\GM21867-PA 45 GM21867-PA 1..45 1..45 192 82.2 Plus
Dsec\GM21872-PA 40 GM21872-PA 1..40 1..44 121 59.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11365-PA 45 GD11365-PA 1..45 1..45 222 97.8 Plus
Dsim\GD11363-PA 45 GD11363-PA 1..45 1..45 209 88.9 Plus
Dsim\GD11364-PA 45 GD11364-PA 1..45 1..45 191 80 Plus
Dsim\GD11366-PA 39 GD11366-PA 1..39 1..43 129 65.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19885-PA 45 GJ19885-PA 1..45 1..45 218 95.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23232-PA 68 GK23232-PA 1..45 1..45 227 97.8 Plus
Dwil\GK22977-PA 45 GK22977-PA 1..45 1..45 222 97.8 Plus
Dwil\GK23991-PA 40 GK23991-PA 1..39 1..43 132 65.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11953-PA 40 GE11953-PA 1..40 1..44 134 63.6 Plus