BDGP Sequence Production Resources |
Search the DGRC for RH08291
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 82 |
Well: | 91 |
Vector: | pFlc-1 |
Associated Gene/Transcript | IM2-RA |
Protein status: | RH08291.pep: gold |
Sequenced Size: | 383 |
Gene | Date | Evidence |
---|---|---|
CG18106 | 2001-12-17 | Blastp of sequenced clone |
CG18106 | 2002-01-01 | Sim4 clustering to Release 2 |
IM2 | 2008-04-29 | Release 5.5 accounting |
IM2 | 2008-08-15 | Release 5.9 accounting |
IM2 | 2008-12-18 | 5.12 accounting |
383 bp (383 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071680
> RH08291.complete GATCAGTTGAATTCAATCGATTGCTTGTGCATTTAGCAAATCAAAGCCAC AACAACCAAACCAGAATCAATATGAAGTTCTTCTCAGTCGTCACCGTCTT TGTGTTCGGTCTGCTGGCTCTGGCCAACGCTGTTCCCCTGTCGCCCGATC CAGGAAATGTGGTAATCAACGGGGACTGCAAATACTGCAATGTGCACGGT GGAAAGTAGGAAAGTAGGAAAGTAGGAAAGTACTCGCCTTAATTTCGAAG ATGGGCCAAAACTTACCTCAAATCCAAAGCACCATATTTATACTCTCACT CTTGTACTAAAATGAAAACTAGTAGTAAAAAATACATCGCCAATTACAAA TAAAATGGTGAAAAAACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 14273836..14274058 | 129..367 | 875 | 92.1 | Plus |
chr2R | 21145070 | chr2R | 14273645..14273774 | 2..129 | 570 | 97.7 | Plus |
chr2R | 21145070 | chr2R | 14271060..14271133 | 54..127 | 295 | 93.2 | Plus |
chr2R | 21145070 | chr2R | 14271201..14271284 | 129..212 | 240 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 18386792..18387034 | 129..371 | 1215 | 100 | Plus |
2R | 25286936 | 2R | 18386603..18386730 | 2..129 | 640 | 100 | Plus |
2R | 25286936 | 2R | 18384012..18384078 | 61..127 | 275 | 94 | Plus |
2R | 25286936 | 2R | 18384149..18384232 | 129..212 | 225 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 18387991..18388233 | 129..371 | 1215 | 100 | Plus |
2R | 25260384 | 2R | 18387802..18387929 | 2..129 | 640 | 100 | Plus |
2R | 25260384 | 2R | 18385211..18385277 | 61..127 | 275 | 94 | Plus |
2R | 25260384 | 2R | 18385348..18385431 | 129..212 | 225 | 84.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 14273643..14273774 | 1..129 | 96 | -> | Plus |
chr2R | 14273837..14273907 | 130..200 | 98 | == | Plus |
chr2R | 14273924..14274058 | 233..367 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 1..138 | 72..209 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 5..372 | 1..367 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 5..372 | 1..367 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 2..367 | 2..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 5..372 | 1..367 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
IM2-RA | 2..367 | 2..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18386601..18386730 | 1..129 | 99 | -> | Plus |
2R | 18386793..18387030 | 130..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18386601..18386730 | 1..129 | 99 | -> | Plus |
2R | 18386793..18387030 | 130..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18386601..18386730 | 1..129 | 99 | -> | Plus |
2R | 18386793..18387030 | 130..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 14274298..14274535 | 130..367 | 100 | Plus | |
arm_2R | 14274106..14274235 | 1..129 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 18387800..18387929 | 1..129 | 99 | -> | Plus |
2R | 18387992..18388229 | 130..367 | 100 | Plus |
Translation from 0 to 208
> RH08291.hyp ASVEFNRLLVHLANQSHNNQTRINMKFFSVVTVFVFGLLALANAVPLSPD PGNVVINGDCKYCNVHGGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM2-PA | 45 | CG18106-PA | 1..45 | 25..69 | 241 | 100 | Plus |
IM1-PA | 45 | CG18108-PA | 1..45 | 25..69 | 220 | 88.9 | Plus |
CG18107-PA | 45 | CG18107-PA | 1..45 | 25..69 | 202 | 80 | Plus |
CG15068-PA | 40 | CG15068-PA | 1..39 | 25..67 | 132 | 65.1 | Plus |
IM3-PB | 39 | CG16844-PB | 1..37 | 25..65 | 130 | 68.3 | Plus |
Translation from 71 to 208
> RH08291.pep MKFFSVVTVFVFGLLALANAVPLSPDPGNVVINGDCKYCNVHGGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12155-PA | 45 | GF12155-PA | 1..45 | 1..45 | 222 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21876-PA | 45 | GG21876-PA | 1..45 | 1..45 | 213 | 91.1 | Plus |
Dere\GG21874-PA | 45 | GG21874-PA | 1..45 | 1..45 | 210 | 91.1 | Plus |
Dere\GG21875-PA | 45 | GG21875-PA | 1..45 | 1..45 | 183 | 77.8 | Plus |
Dere\GG21877-PA | 39 | GG21877-PA | 1..39 | 1..43 | 130 | 67.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
IM2-PA | 45 | CG18106-PA | 1..45 | 1..45 | 241 | 100 | Plus |
IM1-PA | 45 | CG18108-PA | 1..45 | 1..45 | 220 | 88.9 | Plus |
CG18107-PA | 45 | CG18107-PA | 1..45 | 1..45 | 202 | 80 | Plus |
CG15068-PA | 40 | CG15068-PA | 1..39 | 1..43 | 132 | 65.1 | Plus |
IM3-PB | 39 | CG16844-PB | 1..37 | 1..41 | 130 | 68.3 | Plus |
IM3-PA | 39 | CG16844-PA | 1..37 | 1..41 | 130 | 68.3 | Plus |
CG15065-PA | 40 | CG15065-PA | 1..40 | 1..44 | 126 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20115-PA | 45 | GI20115-PA | 1..45 | 1..45 | 222 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17764-PA | 45 | GL17764-PA | 1..45 | 1..45 | 222 | 97.8 | Plus |
Dper\GL16705-PA | 40 | GL16705-PA | 1..39 | 1..43 | 125 | 62.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14796-PA | 45 | GA14796-PA | 1..45 | 1..45 | 222 | 97.8 | Plus |
Dpse\GA30478-PA | 40 | GA30478-PA | 1..39 | 1..43 | 127 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21868-PA | 45 | GM21868-PA | 1..45 | 1..45 | 227 | 100 | Plus |
Dsec\GM21866-PA | 45 | GM21866-PA | 1..45 | 1..45 | 209 | 88.9 | Plus |
Dsec\GM21867-PA | 45 | GM21867-PA | 1..45 | 1..45 | 192 | 82.2 | Plus |
Dsec\GM21872-PA | 40 | GM21872-PA | 1..40 | 1..44 | 121 | 59.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11365-PA | 45 | GD11365-PA | 1..45 | 1..45 | 222 | 97.8 | Plus |
Dsim\GD11363-PA | 45 | GD11363-PA | 1..45 | 1..45 | 209 | 88.9 | Plus |
Dsim\GD11364-PA | 45 | GD11364-PA | 1..45 | 1..45 | 191 | 80 | Plus |
Dsim\GD11366-PA | 39 | GD11366-PA | 1..39 | 1..43 | 129 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19885-PA | 45 | GJ19885-PA | 1..45 | 1..45 | 218 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23232-PA | 68 | GK23232-PA | 1..45 | 1..45 | 227 | 97.8 | Plus |
Dwil\GK22977-PA | 45 | GK22977-PA | 1..45 | 1..45 | 222 | 97.8 | Plus |
Dwil\GK23991-PA | 40 | GK23991-PA | 1..39 | 1..43 | 132 | 65.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11953-PA | 40 | GE11953-PA | 1..40 | 1..44 | 134 | 63.6 | Plus |